We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for (R)-3-Hydroxybutyric acid (HMDB00011)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2005-11-16 15:48:42
Update Date 2009-12-03 09:55:56
Accession Number HMDB00011
Secondary Accession Numbers Not Available
Common Name (R)-3-Hydroxybutyric acid
Description (R)-3-Hydroxybutyric acid is a butyric acid substituted with a hydroxyl group in the beta or 3 position. It is involved in the synthesis and degradation of ketone bodies. Like the other ketone bodies (acetoacetate and acetone), levels of beta-hydroxybutyrate are raised in the blood and urine in ketosis. This acid is metabolized by 3-hydroxybutyrate dehydrogenase (catalyzes the oxidation of D-3-hydroxybutyrate to form acetoacetate, using NAD+ as an electron acceptor). The enzyme functions in nervous tissues and muscles, enabling the use of circulating hydroxybutyrate as a fuel. In the liver mitochondrial matrix, the enzyme can also catalyze the reverse reaction, a step in ketogenesis. 3-Hydroxybutyric acid is a chiral compound having two enantiomers, D-3-hydroxybutyric acid and L-3-hydroxybutyric acid. In humans, beta-hydroxybutyrate is synthesized in the liver from acetyl-CoA, and can be used as an energy source by the brain when blood glucose is low. It can also be used for the synthesis of biodegradable plastics (Wikipedia).
Synonyms
  1. (R)-(-)-b-Hydroxybutyrate
  2. (R)-(-)-b-Hydroxybutyric acid
  3. (R)-3-Hydroxybutanoate
  4. (R)-3-Hydroxybutanoic acid
  5. (R)-3-Hydroxybutyrate
  6. D-(-)-3-hydroxybutyrate
  7. D-3-hydroxybutyrate
  8. D-3-hydroxybutyric acid
  9. D-beta-hydroxybutyrate
  10. (R)-(-)-beta-Hydroxybutyrate
  11. (R)-(-)-beta-Hydroxybutyric acid
  12. delta-(-)-3-hydroxybutyrate
  13. delta-3-hydroxybutyrate
  14. delta-3-hydroxybutyric acid
  15. delta-beta-hydroxybutyrate
  16. 3-D-hydroxybutyrate
  17. 3-D-hydroxybutyric acid
  18. 3-delta-hydroxybutyrate
  19. 3-delta-hydroxybutyric acid
Chemical IUPAC Name (3R)-3-hydroxybutanoic acid
Chemical Formula C4H8O3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Hydroxy Acids
Sub Class
  • Short chain hydroxy acids
Family
  • Mammalian Metabolite
Species
  • secondary alcohol
  • carboxylic acid
Biofunction
  • Component of Butanoate metabolism
Application
—
Source
  • Endogenous
Average Molecular Weight 104.104
Monoisotopic Molecular Weight 104.047340
Isomeric SMILES C[C@@H](O)CC(O)=O
Canonical SMILES CC(O)CC(O)=O
KEGG Compound ID C01089 Link Image
BioCyc ID CPD-335 Link Image
BiGG ID 36784 Link Image
Wikipedia Link Not Available
NuGOwiki Link HMDB00011 Link Image
Metagene Link HMDB00011 Link Image
METLIN ID Not Available
PubChem Compound 92135 Link Image
PubChem Substance 4324 Link Image
ChEBI ID 17066 Link Image
CAS Registry Number 625-72-9
InChI Identifier InChI=1/C4H8O3/c1-3(5)2-4(6)7/h3,5H,2H2,1H3,(H,6,7)/t3-/m1/s1
Synthesis Reference Le Sann, Christine; Munoz, Dulce M.; Saunders, Natalie; Simpson, Thomas J.; Smith, David I.; Soulas, Florilene; Watts, Paul; Willis, Christine L. Assembly intermediates in polyketide biosynthesis: enantioselective syntheses of b-hydroxycarbonyl compounds
Melting Point (Experimental) 49-50 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 539.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.50 [Predicted by ALOGPS]; -0.5 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • Extracellular
  • mitochondria
Biofluid Location
  • Blood
  • Cerebrospinal Fluid
  • Urine
Tissue Location Not Available
Concentrations (Normal)
Biofluid Blood
Value 36 +/- 20 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Hansen JL, Freier EF: Direct assays of lactate, pyruvate, beta-hydroxybutyrate, and acetoacetate with a centrifugal analyzer. Clin Chem. 1978 Mar;24(3):475-9. [PubMed Link Image]
Biofluid Blood
Value 86 +/- 53 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Ozand PT, Hawkins RL, Collins RM Jr, Tildon JT, Cornblath M: A micro-autoanalytic procedure developed for the determination of ketone bodies, gluconeogenic amino acids, pyruvate, lactate, and glucose in metabolic studies. Biochem Med. 1975 Oct;14(2):170-83. [PubMed Link Image]
Biofluid Blood
Value 38 +/- 31 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Wildenhoff KE: Diurnal variations in the concentrations of blood acetoacetate, 3-hydroxybutyrate and glucose in normal persons. Acta Med Scand. 1972 Apr;191(4):303-6. [PubMed Link Image]
Biofluid CSF
Value 286 (207-365) uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Subramanian A, Gupta A, Saxena S, Gupta A, Kumar R, Nigam A, Kumar R, Mandal SK, Roy R: Proton MR CSF analysis and a new software as predictors for the differentiation of meningitis in children. NMR Biomed. 2005 Jun;18(4):213-25. [PubMed Link Image]
Biofluid Urine
Value 3.4 umol/mmol creatinine
Age Adult:>18 yrs old
Sex N/A
Patient information Normal
Comments Not Available
References
  • Bales JR, Higham DP, Howe I, Nicholson JK, Sadler PJ: Use of high-resolution proton nuclear magnetic resonance spectroscopy for rapid multi-component analysis of urine. Clin Chem. 1984 Mar;30(3):426-32. [PubMed Link Image]
Biofluid Urine
Value 48.0 (0.00-200.0) umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Bales JR, Higham DP, Howe I, Nicholson JK, Sadler PJ: Use of high-resolution proton nuclear magnetic resonance spectroscopy for rapid multi-component analysis of urine. Clin Chem. 1984 Mar;30(3):426-32. [PubMed Link Image]
Concentrations (Abnormal)
Biofluid Blood
Value 7700.0 +/- 300.0 uM
Age Children:1-13 yrs old
Sex Both
Condition Diabetes mellitus type 2
Comments With diabetic ketoacidosis
References
  • Sheikh-Ali M, Karon BS, Basu A, Kudva YC, Muller LA, Xu J, Schwenk WF, Miles JM: Can serum beta-hydroxybutyrate be used to diagnose diabetic ketoacidosis? Diabetes Care. 2008 Apr;31(4):643-7. Epub 2008 Jan 9. [PubMed Link Image]
Biofluid Blood
Value 1400.0 +/- 100.0 uM
Age Adult:>18 yrs old
Sex Both
Condition Diabetes mellitus type 2
Comments Without diabetic ketoacidosis
References
  • Sheikh-Ali M, Karon BS, Basu A, Kudva YC, Muller LA, Xu J, Schwenk WF, Miles JM: Can serum beta-hydroxybutyrate be used to diagnose diabetic ketoacidosis? Diabetes Care. 2008 Apr;31(4):643-7. Epub 2008 Jan 9. [PubMed Link Image]
Biofluid Blood
Value 7700.0 +/- 200.0 uM
Age Adult:>18 yrs old
Sex Both
Condition Diabetes mellitus type 2
Comments With diabetic ketoacidosis
References
  • Sheikh-Ali M, Karon BS, Basu A, Kudva YC, Muller LA, Xu J, Schwenk WF, Miles JM: Can serum beta-hydroxybutyrate be used to diagnose diabetic ketoacidosis? Diabetes Care. 2008 Apr;31(4):643-7. Epub 2008 Jan 9. [PubMed Link Image]
Biofluid Blood
Value 1500.0 +/- 100.0 uM
Age Children:1-13 yrs old
Sex Both
Condition Diabetes mellitus type 2
Comments Without diabetic ketoacidosis
References
  • Sheikh-Ali M, Karon BS, Basu A, Kudva YC, Muller LA, Xu J, Schwenk WF, Miles JM: Can serum beta-hydroxybutyrate be used to diagnose diabetic ketoacidosis? Diabetes Care. 2008 Apr;31(4):643-7. Epub 2008 Jan 9. [PubMed Link Image]
Biofluid CSF
Value 430 (359-501) uM
Age Adult:>18 yrs old
Sex Both
Condition Meningitis
Comments Bacterial
References
  • Subramanian A, Gupta A, Saxena S, Gupta A, Kumar R, Nigam A, Kumar R, Mandal SK, Roy R: Proton MR CSF analysis and a new software as predictors for the differentiation of meningitis in children. NMR Biomed. 2005 Jun;18(4):213-25. [PubMed Link Image]
Biofluid CSF
Value 6360 (5350-7370) uM
Age Adult:>18 yrs old
Sex Both
Condition Diabetes mellitus type 2
Comments with ketoacidosis
References
  • Tasker RC, Lutman D, Peters MJ: Hyperventilation in severe diabetic ketoacidosis. Pediatr Crit Care Med. 2005 Jul;6(4):405-11. [PubMed Link Image]
Biofluid Urine
Value 224 umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Condition Diabetes mellitus type 2
Comments Not Available
References
  • Bales JR, Higham DP, Howe I, Nicholson JK, Sadler PJ: Use of high-resolution proton nuclear magnetic resonance spectroscopy for rapid multi-component analysis of urine. Clin Chem. 1984 Mar;30(3):426-32. [PubMed Link Image]
Associated Disorders
Condition References
Diabetes mellitus type 2
Meningitis
  • Subramanian A, Gupta A, Saxena S, Gupta A, Kumar R, Nigam A, Kumar R, Mandal SK, Roy R: Proton MR CSF analysis and a new software as predictors for the differentiation of meningitis in children. NMR Biomed. 2005 Jun;18(4):213-25. [PubMed Link Image]
OMIM ID
Pathways
Name SMPDB Link KEGG Link
Ketone Body Metabolism SMP00071 Link Image map00072 Link Image
General References
  1. Pan JW, Rothman TL, Behar KL, Stein DT, Hetherington HP: Human brain beta-hydroxybutyrate and lactate increase in fasting-induced ketosis. J Cereb Blood Flow Metab. 2000 Oct;20(10):1502-7. [PubMed Link Image]
  2. Pan JW, Telang FW, Lee JH, de Graaf RA, Rothman DL, Stein DT, Hetherington HP: Measurement of beta-hydroxybutyrate in acute hyperketonemia in human brain. J Neurochem. 2001 Nov;79(3):539-44. [PubMed Link Image]
  3. Plecko B, Stoeckler-Ipsiroglu S, Schober E, Harrer G, Mlynarik V, Gruber S, Moser E, Moeslinger D, Silgoner H, Ipsiroglu O: Oral beta-hydroxybutyrate supplementation in two patients with hyperinsulinemic hypoglycemia: monitoring of beta-hydroxybutyrate levels in blood and cerebrospinal fluid, and in the brain by in vivo magnetic resonance spectroscopy. Pediatr Res. 2002 Aug;52(2):301-6. [PubMed Link Image]
  4. Raunio RP, Leivo PV, Kuusinen AM: Bioluminescent assay of D-3-hydroxybutyrate in serum. J Biolumin Chemilumin. 1986 Jun;1(1):11-4. [PubMed Link Image]
  5. Bernardi, R. et al., Chem. Comm., 1984, 460, (resoln)
  6. Encyclopedia of Food and Color Additives, (ed. Burdock, G.A.), CRC Press, 1997, 994-995, (Et ester)
  7. Fenaroli's Handbook of Flavor Ingredients, 3rd edn., (ed. Burdock, G.A.), CRC Press, 1995, 1, 238, (Et ester)
  8. Forsyth, W.G.C. et al., Nature (London), 1958, 182, 800, (isol)
  9. Gottschulk, G. et al., Nature (London), 1965, 205, 308
  10. Krajewski, D. et al., Phytochemistry, 1997, 45, 1627, (ester glucosides)
  11. Levene, P.A. et al., J. Biol. Chem., 1926, 68, 418, (abs config)
  12. Lewis, R.J., Sax's Dangerous Properties of Industrial Materials, 8th edn., Van Nostrand Reinhold, 1992, MEF500 MKP250
  13. Marchessault, R.H. et al., Makromol. Chem., Macromol. Symp., 1988, 19, 235, (rev, polymers)
  14. Muller, H.-M. et al., Angew. Chem., Int. Ed., 1993, 32, 477, (rev, polymer)
  15. Org. Synth., 1993, 71, 39, (synth, acid, Me ester, pmr, ir)
  16. Quang, D.N. et al., J. Nat. Prod., 2003, 66, 1613-1614, (dimer, trimer, isol)
  17. Schulz, S. et al., Science (Washington, D.C.), 1993, 260, 1635-1637, (dimer)
  18. Seebach, D. et al., Helv. Chim. Acta, 1982, 65, 495-503, (esters, synth)
  19. Seebach, D. et al., Helv. Chim. Acta, 1988, 71, 155, (synth, dimer)
  20. Wipf, B. et al., Helv. Chim. Acta, 1983, 66, 485
Metabolic Enzymes
  1. D-beta-hydroxybutyrate dehydrogenase, mitochondrial precursor
  2. 3-hydroxybutyrate dehydrogenase type 2
  3. Putative uncharacterized protein DKFZp434G1411
Enzyme 1 [top]
Enzyme 1 ID 5800
Enzyme 1 Name D-beta-hydroxybutyrate dehydrogenase, mitochondrial precursor
Enzyme 1 Synonyms
  1. BDH
  2. 3-hydroxybutyrate dehydrogenase
Enzyme 1 Gene Name BDH1
Enzyme 1 Protein Sequence >D-beta-hydroxybutyrate dehydrogenase, mitochondrial precursor 
MLATRLSRPLSRLPGKTLSACDRENGARRPLLLGSTSFIPIGRRTYASAAEPVGSKAVLV
TGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEV
EKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFL
PLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGN
FIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVID
AVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR
Enzyme 1 Number of Residues 343
Enzyme 1 Molecular Weight 38158
Enzyme 1 Theoretical pI 9.24
Enzyme 1 GO Classification
Function
  • catalytic activity
  • oxidoreductase activity
Process
  • metabolism
  • physiological process
Component
—
Enzyme 1 General Function Lipid transport and metabolism
Enzyme 1 Specific Function (R)-3-hydroxybutanoate + NAD(+) = acetoacetate + NADH
Enzyme 1 Pathways
Enzyme 1 Reactions
  • (R)-3-hydroxybutanoate + NAD+ = acetoacetate + NADH + H+
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 177198 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q02338 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name BDH_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1032 bp 
GGCCTGCGGCCTCCGCCACCCGGACGCTTCTCACGGCTCCCAGGAAAAACCCTAAGTGCC
TGTGATAGAGAAAATGGAGCAAGACGCCCACTATTGCTTGGTTCTACTTCCTTTATCCCG
ATTGGCCGTCGGACTTATGCCAGTGCGGCGGAGCCGGTTGGCAGCAAAGCTGTCCTGGTC
ACAGGCTGTGACTCTGGATTTGGGTTCTCATTGGCCAAGCATCTGCATTCAAAAGGCTTC
CTTGTGTTTGCTGGCTGCTTGATGAAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGAC
AGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTTCAGAAGCGAAGAGGTG
GAGAAAGTGGTGGGAGATTGTCCGTTCGAGCCTGAAGGACCTGAGAAAGGCATGTGGGGG
CTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACC
TACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTC
CCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATG
GCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGAC
TGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAAC
TTCATCGCTGCCACCAGCCTTTACAACCCTGAGAGCATTCAGGCCATCGCCAAGAAGATG
TGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAG
ATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGAT
GCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTAC
TACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATC
TACATCCGCTGA
Enzyme 1 GenBank Gene ID M93107 Link Image
Enzyme 1 GeneCard ID BDH1 Link Image
Enzyme 1 GenAtlas ID BDH1 Link Image
Enzyme 1 HGNC ID HGNC:1027 Link Image
Enzyme 1 Chromosome Location 3
Enzyme 1 Locus 3q29
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. Marks AR, McIntyre JO, Duncan TM, Erdjument-Bromage H, Tempst P, Fleischer S: Molecular cloning and characterization of (R)-3-hydroxybutyrate dehydrogenase from human heart. J Biol Chem. 1992 Aug 5;267(22):15459-63. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 12878
Enzyme 2 Name 3-hydroxybutyrate dehydrogenase type 2
Enzyme 2 Synonyms
  1. R-beta- hydroxybutyrate dehydrogenase
  2. Dehydrogenase/reductase SDR family member 6
  3. Oxidoreductase UCPA
Enzyme 2 Gene Name BDH2
Enzyme 2 Protein Sequence >3-hydroxybutyrate dehydrogenase type 2 
MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID
GGWSL
Enzyme 2 Number of Residues 245
Enzyme 2 Molecular Weight 26724
Enzyme 2 Theoretical pI Not Available
Enzyme 2 GO Classification
Function
  • catalytic activity
  • oxidoreductase activity
Process
  • metabolism
  • physiological process
Component
—
Enzyme 2 General Function Lipid transport and metabolism
Enzyme 2 Specific Function (R)-3-hydroxybutanoate + NAD(+) = acetoacetate + NADH
Enzyme 2 Pathways
Enzyme 2 Reactions
  • (R)-3-hydroxybutanoate + NAD+ = acetoacetate + NADH + H+ [RN:R01361] ALL_REAC R01361
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 8895083 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q9BUT1 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name BDH2_HUMAN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence Not Available
Enzyme 2 GenBank Gene ID AF164790 Link Image
Enzyme 2 GeneCard ID Not Available
Enzyme 2 GenAtlas ID BDH2 Link Image
Enzyme 2 HGNC ID HGNC:32389 Link Image
Enzyme 2 Chromosome Location Not Available
Enzyme 2 Locus Not Available
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed Link Image]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 14846
Enzyme 3 Name Putative uncharacterized protein DKFZp434G1411
Enzyme 3 Synonyms
  1. OTTHUMP00000016649
Enzyme 3 Gene Name DKFZp434G1411
Enzyme 3 Protein Sequence >Putative uncharacterized protein DKFZp434G1411 
AAPGSAMGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIVEVG
PRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQVAAGATEISVFGAAS
ESFSKKNINCSIEESMGKFEEVVKSARHMNIPARGYL
Enzyme 3 Number of Residues 157
Enzyme 3 Molecular Weight 16899
Enzyme 3 Theoretical pI 5.69
Enzyme 3 GO Classification
Function
  • catalytic activity
Process
—
Component
—
Enzyme 3 General Function Amino acid transport and metabolism
Enzyme 3 Specific Function Not Available
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 6808353 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q9NT06 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name Q9NT06_HUMAN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >474 bp 
GCCGCCCCAGGCTCCGCCATGGGGAATGTGCCATCCGCGGTGAAGCACTGCCTCAGCTAC
CAGCAGCTTCTCCGGGAGCATCTCTGGATCGGGGATTCAGTGGCAGGGGCGCTCGACCCC
GCGCAGGAAACATCCCAGTTATCTGGACTCCCTGAGTTTGTTAAAATAGTAGAAGTTGGG
CCTAGGGATGGATTGCAGAATGAAAAGGTTATAGTTCCTACAGATATAAAAATTGAATTT
ATCAATCGACTTTCCCAAACTGGCTTGTCTGTAATAGAAGTGACTAGCTTTGTGTCTTCC
AGATGGGTACCACAGGTTGCTGCTGGAGCTACTGAGATATCAGTTTTTGGAGCTGCATCT
GAATCCTTTAGCAAGAAGAATATTAACTGTTCCATTGAAGAAAGTATGGGAAAATTTGAG
GAGGTTGTTAAGTCTGCAAGACACATGAATATTCCAGCACGAGGGTACTTATGA
Enzyme 3 GenBank Gene ID AL137605 Link Image
Enzyme 3 GeneCard ID Q9NT06 Link Image
Enzyme 3 GenAtlas ID DKFZp434G1411 Link Image
Enzyme 3 HGNC ID HGNC:21359 Link Image
Enzyme 3 Chromosome Location Not Available
Enzyme 3 Locus Not Available
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References
  1. Gibson KM, Lee CF, Kamali V, Johnston K, Beaudet AL, Craigen WJ, Powell BR, Schwartz R, Tsai MY, Tuchman M: 3-Hydroxy-3-methylglutaryl-CoA lyase deficiency as detected by radiochemical assay in cell extracts by thin-layer chromatography, and identification of three new cases. Clin Chem. 1990 Feb;36(2):297-303. [PubMed Link Image]