| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2010-03-12 10:53:38 |
| Accession Number |
HMDB00211 |
| Secondary Accession Numbers |
HMDB02256 |
| Common Name |
Myoinositol |
| Description |
Inositol is a cyclic polyalcohol that plays an important role as a second messenger in a cell, in the form of inositol phosphates. It is found in many foods, particularly in cereals with high bran content. It is an isomer of glucose that has traditionally been considered to be a B vitamin although it has an uncertain status as a vitamin and a deficiency syndrome has not been identified in man. (From Martindale, The Extra Pharmacopoeia, 30th ed., p1379) Inositol phospholipids are important in signal transduction. |
| Synonyms |
- MI
- Meat sugar
- Myo-Inositol
- Myoinosite
- Myoinositol
- Phaseomannite
- Rat antispectacled eye factor
- cis-1,2,3,5-trans-4,6-Cyclohexanehexol
- i-Inositol
- iso-Inositol
- meso-Inositol
|
| Chemical IUPAC Name |
(1r,2R,3S,4s,5R,6S)-cyclohexane-1,2,3,4,5,6-hexol |
| Chemical Formula |
C6H12O6 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
|
| Class |
|
| Sub Class |
|
| Family |
|
| Species |
- secondary alcohol
- 1,2-diol
|
| Biofunction |
- Osmolyte
- Second messenger
- Component of Glycerophospholipid metabolism
- Component of Inositol phosphate metabolism
- Component of Streptomycin biosynthesis
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
180.156 |
| Monoisotopic Molecular Weight |
180.063385 |
| Isomeric SMILES |
O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O |
| Canonical SMILES |
OC1C(O)C(O)C(O)C(O)C1O |
| KEGG Compound ID |
C00137  |
| BioCyc ID |
MYO-INOSITOL  |
| BiGG ID |
33990  |
| Wikipedia Link |
MI  |
| NuGOwiki Link |
HMDB00211  |
| Metagene Link |
HMDB00211  |
| METLIN ID |
5221  |
| PubChem Compound |
892  |
| PubChem Substance |
10355714  |
| ChEBI ID |
17268  |
| CAS Registry Number |
87-89-8 |
| InChI Identifier |
InChI=1/C6H12O6/c7-1-2(8)4(10)6(12)5(11)3(1)9/h1-12H/t1-,2-,3-,4+,5-,6- |
| Synthesis Reference |
Iselin, Beat M. Synthesis of inositol-5-monophosphoric acid and scyllitol monophosphoric acid. Journal of the American Chemical Society (1949), 71 3822-5. |
| Melting Point (Experimental) |
225 oC |
| Experimental Water Solubility |
143 mg/mL at 19 oC [YALKOWSKY,SH & DANNENFELSER,RM (1992)]; 143.0 mg/mL at 19 oC [YALKOWSKY,SH & DANNENFELSER,RM (1992)]
Source: PhysProp
|
| Predicted Water Solubility |
485.0 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
0 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
-2.08 [MEYLAN,WM & HOWARD,PH (1995)]; -2.59 [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
|
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Download Spectrum Download FID (Varian) Show Experimental Conditions  |
| Experimental 13C NMR Spectrum |
Download Spectrum Download FID (Bruker) Show Experimental Conditions  |
| Experimental 13C HSQC Spectrum |
Download Spectrum Download FID (Bruker) Show Experimental Conditions  |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
|
| Simplified TOCSY Spectrum |
Show Image Show Peaklist |
| BMRB Spectrum |
Show Image Show Peaklist |
| Cellular Location |
- Cytoplasm (Predicted from LogP)
- Extracellular
|
| Biofluid Location |
- Blood
- Cerebrospinal Fluid
- Urine
|
| Tissue Location |
| Tissue |
References |
| Basal Ganglia |
— |
| Brain |
— |
| Fibroblasts |
— |
| Intestine |
— |
| Kidney |
— |
| Myelin |
— |
| Nerve Cells |
— |
| Neuron |
— |
| Testes |
— |
|
| Concentrations (Normal) |
| Biofluid |
Blood |
| Value |
24.0 +/- 7.8 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
| Biofluid |
Blood |
| Value |
23.0 +/- 8.0 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
| Biofluid |
Blood |
| Value |
30.0 (21.0-49.0) uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Huck JH, Verhoeven NM, Struys EA, Salomons GS, Jakobs C, van der Knaap MS: Ribose-5-phosphate isomerase deficiency: new inborn error in the pentose phosphate pathway associated with a slowly progressive leukoencephalopathy. Am J Hum Genet. 2004 Apr;74(4):745-51. Epub 2004 Feb 25. [PubMed
]
|
| Biofluid |
CSF |
| Value |
158.8 +/- 46.07 uM |
| Age |
Adult:>18 yrs old |
| Sex |
N/A |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Huang W, Alexander GE, Daly EM, Shetty HU, Krasuski JS, Rapoport SI, Schapiro MB: High brain myo-inositol levels in the predementia phase of Alzheimer's disease in adults with Down's syndrome: a 1H MRS study. Am J Psychiatry. 1999 Dec;156(12):1879-86. [PubMed
]
- De Stefano N, Mortilla M, Federico A: Proton magnetic resonance spectroscopy of the brain in dementia. Ital J Neurol Sci. 1999;20(5 Suppl):S258-64. [PubMed
]
- Groenen PM, Peer PG, Wevers RA, Swinkels DW, Franke B, Mariman EC, Steegers-Theunissen RP: Maternal myo-inositol, glucose, and zinc status is associated with the risk of offspring with spina bifida. Am J Obstet Gynecol. 2003 Dec;189(6):1713-9. [PubMed
]
- Groenen PM, Klootwijk R, Schijvenaars MM, Straatman H, Mariman EC, Franke B, Steegers-Theunissen RP: Spina bifida and genetic factors related to myo-inositol, glucose, and zinc. Mol Genet Metab. 2004 Jun;82(2):154-61. [PubMed
]
- Dunne VG, Bhattachayya S, Besser M, Rae C, Griffin JL: Metabolites from cerebrospinal fluid in aneurysmal subarachnoid haemorrhage correlate with vasospasm and clinical outcome: a pattern-recognition 1H NMR study. NMR Biomed. 2005 Feb;18(1):24-33. [PubMed
]
- A J, Trygg J, Gullberg J, Johansson AI, Jonsson P, Antti H, Marklund SL, Moritz T: Extraction and GC/MS analysis of the human blood plasma metabolome. Anal Chem. 2005 Dec 15;77(24):8086-94. [PubMed
]
- Shoda J, Tanaka N, Osuga T, Matsuura K, Miyazaki H: Altered bile acid metabolism in liver disease: concurrent occurrence of C-1 and C-6 hydroxylated bile acid metabolites and their preferential excretion into urine. J Lipid Res. 1990 Feb;31(2):249-59. [PubMed
]
- Kusmierz J, DeGeorge JJ, Sweeney D, May C, Rapoport SI: Quantitative analysis of polyols in human plasma and cerebrospinal fluid. J Chromatogr. 1989 Dec 29;497:39-48. [PubMed
]
- Shoda J, Mahara R, Osuga T, Tohma M, Ohnishi S, Miyazaki H, Tanaka N, Matsuzaki Y: Similarity of unusual bile acids in human umbilical cord blood and amniotic fluid from newborns and in sera and urine from adult patients with cholestatic liver diseases. J Lipid Res. 1988 Jul;29(7):847-58. [PubMed
]
- Shetty HU, Schapiro MB, Holloway HW, Rapoport SI: Polyol profiles in Down syndrome. myo-Inositol, specifically, is elevated in the cerebrospinal fluid. J Clin Invest. 1995 Feb;95(2):542-6. [PubMed
]
- Shetty HU, Holloway HW, Schapiro MB: Cerebrospinal fluid and plasma distribution of myo-inositol and other polyols in Alzheimer disease. Clin Chem. 1996 Feb;42(2):298-302. [PubMed
]
- Acevedo LD, Holloway HW, Rapoport SI, Shetty HU: Application of stable isotope tracer combined with mass spectrometric detection for studying myo-inositol uptake by cultured neurons from fetal mouse: effect of trisomy 16. J Mass Spectrom. 1997 Apr;32(4):395-400. [PubMed
]
- Michaelis T, Videen JS, Linsey MS, Ross BD: Dialysis and transplantation affect cerebral abnormalities of end-stage renal disease. J Magn Reson Imaging. 1996 Mar-Apr;6(2):341-7. [PubMed
]
|
| Biofluid |
CSF |
| Value |
133.0 (111.0-155.0) uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Shetty HU, Holloway HW, Rapoport SI: Capillary gas chromatography combined with ion trap detection for quantitative profiling of polyols in cerebrospinal fluid and plasma. Anal Biochem. 1995 Jan 1;224(1):279-85. [PubMed
]
|
| Biofluid |
CSF |
| Value |
174.0 +/- 31.0 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
| Biofluid |
CSF |
| Value |
138.3 +/- 24.4 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Shetty HU, Holloway HW, Schapiro MB: Cerebrospinal fluid and plasma distribution of myo-inositol and other polyols in Alzheimer disease. Clin Chem. 1996 Feb;42(2):298-302. [PubMed
]
|
| Biofluid |
CSF |
| Value |
84 +/- 40 uM |
| Age |
N/A |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Wishart DS, Lewis MJ, Morrissey JA, Flegel MD, Jeroncic K, Xiong Y, Cheng D, Eisner R, Gautam B, Tzur D, Sawhney S, Bamforth F, Greiner R, Li L: The human cerebrospinal fluid metabolome. J Chromatogr B Analyt Technol Biomed Life Sci. 2008 Aug 15;871(2):164-173. Epub 2008 May 8. [PubMed
]
|
| Biofluid |
Urine |
| Value |
52.8 +/- 47.7 umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 130. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp. Basel, Switzerland c1981-1992.
|
| Biofluid |
Urine |
| Value |
6.11 +/- 6.25 umol/mmol creatinine |
| Age |
Infant:0-1 yr old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Shoemaker JD, Elliott WH: Automated screening of urine samples for carbohydrates, organic and amino acids after treatment with urease. J Chromatogr. 1991 Jan 2;562(1-2):125-38. [PubMed
]
|
|
| Concentrations (Abnormal) |
| Biofluid |
Blood |
| Value |
20.0 (23.0–24.0) uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Condition |
Ribose-5-phosphate isomerase deficiency |
| Comments |
Not Available |
| References |
- Huck JH, Verhoeven NM, Struys EA, Salomons GS, Jakobs C, van der Knaap MS: Ribose-5-phosphate isomerase deficiency: new inborn error in the pentose phosphate pathway associated with a slowly progressive leukoencephalopathy. Am J Hum Genet. 2004 Apr;74(4):745-51. Epub 2004 Feb 25. [PubMed
]
|
| Biofluid |
CSF |
| Value |
158.8 +/- 27.2 uM |
| Age |
N/A |
| Sex |
N/A |
| Condition |
Alzheimer's disease |
| Comments |
Not Available |
| References |
- Shetty HU, Holloway HW, Schapiro MB: Cerebrospinal fluid and plasma distribution of myo-inositol and other polyols in Alzheimer disease. Clin Chem. 1996 Feb;42(2):298-302. [PubMed
]
|
| Biofluid |
CSF |
| Value |
158.8 +/- 27.2 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Condition |
Alzheimer's disease |
| Comments |
Not Available |
| References |
- Shetty HU, Holloway HW, Schapiro MB: Cerebrospinal fluid and plasma distribution of myo-inositol and other polyols in Alzheimer disease. Clin Chem. 1996 Feb;42(2):298-302. [PubMed
]
|
| Biofluid |
Urine |
| Value |
20.33 +/- 13.70 umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
N/A |
| Condition |
Cachexia |
| Comments |
Not Available |
| References |
|
|
| Associated Disorders |
| Condition |
References |
| Alzheimer's disease |
- Shetty HU, Holloway HW, Schapiro MB: Cerebrospinal fluid and plasma distribution of myo-inositol and other polyols in Alzheimer disease. Clin Chem. 1996 Feb;42(2):298-302. [PubMed
]
|
| Cachexia |
— |
| Ribose-5-phosphate isomerase deficiency |
- Huck JH, Verhoeven NM, Struys EA, Salomons GS, Jakobs C, van der Knaap MS: Ribose-5-phosphate isomerase deficiency: new inborn error in the pentose phosphate pathway associated with a slowly progressive leukoencephalopathy. Am J Hum Genet. 2004 Apr;74(4):745-51. Epub 2004 Feb 25. [PubMed
]
|
|
| OMIM ID |
- 104300
(Alzheimer's disease)
- 608611
(Ribose-5-phosphate isomerase deficiency)
|
| Pathways |
|
| General References |
- Gryz EA, Galicka-Latala D, Szczudlik A, Sieradzki J: [Etiopathogenesis of diabetic neuropathy] Przegl Lek. 2000;57(12):727-31. [PubMed
]
- Kim MO, Im JH, Choi CG, Lee MC: Proton MR spectroscopic findings in paroxysmal kinesigenic dyskinesia. Mov Disord. 1998 May;13(3):570-5. [PubMed
]
- Wuarin-Bierman L, Zahnd GR: Current aspects of research on the pathogenesis of diabetic neuropathy. Diabete Metab. 1986 Dec;12(6):319-24. [PubMed
]
- Reznek RH, Salway JG, Thomas PK: Plasma-myoinositol concentrations in uraemic neuropathy. Lancet. 1977 Mar 26;1(8013):675-6. [PubMed
]
- Scully SE, Stebner FC, Yoest SM: Magnetic resonance spectroscopic findings in neuro-Behcet disease. Neurologist. 2004 Nov;10(6):323-6. [PubMed
]
- Cordoba J, Hinojosa C, Sampedro F, Alonso J, Rovira A, Quiroga S, Esteban R, Guardia J: Usefulness of magnetic resonance spectroscopy for diagnosis of hepatic encephalopathy in a patient with relapsing confusional syndrome. Dig Dis Sci. 2001 Nov;46(11):2451-5. [PubMed
]
- Chang L, Ernst T, Leonido-Yee M, Witt M, Speck O, Walot I, Miller EN: Highly active antiretroviral therapy reverses brain metabolite abnormalities in mild HIV dementia. Neurology. 1999 Sep 11;53(4):782-9. [PubMed
]
- Kusmierz J, DeGeorge JJ, Sweeney D, May C, Rapoport SI: Quantitative analysis of polyols in human plasma and cerebrospinal fluid. J Chromatogr. 1989 Dec 29;497:39-48. [PubMed
]
- Ashwal S, Holshouser B, Tong K, Serna T, Osterdock R, Gross M, Kido D: Proton spectroscopy detected myoinositol in children with traumatic brain injury. Pediatr Res. 2004 Oct;56(4):630-8. Epub 2004 Aug 4. [PubMed
]
- Servo C, Pitkanen E: Variation in polyol levels in cerebrospinal fluid and serum in diabetic patients. Diabetologia. 1975 Dec;11(6):575-80. [PubMed
]
- Utriainen M, Komu M, Vuorinen V, Lehikoinen P, Sonninen P, Kurki T, Utriainen T, Roivainen A, Kalimo H, Minn H: Evaluation of brain tumor metabolism with [11C]choline PET and 1H-MRS. J Neurooncol. 2003 May;62(3):329-38. [PubMed
]
- Grzelec H: [Pathogenesis and treatment of diabetic neuropathy] Neurol Neurochir Pol. 1991 Jul-Aug;25(4):477-84. [PubMed
]
- Ernst T, Itti E, Itti L, Chang L: Changes in cerebral metabolism are detected prior to perfusion changes in early HIV-CMC: A coregistered (1)H MRS and SPECT study. J Magn Reson Imaging. 2000 Dec;12(6):859-65. [PubMed
]
- Hallman M, Saugstad OD, Porreco RP, Epstein BL, Gluck L: Role of myoinositol in regulation of surfactant phospholipids in the newborn. Early Hum Dev. 1985 Jan;10(3-4):245-54. [PubMed
]
- Chang L, Lee PL, Yiannoutsos CT, Ernst T, Marra CM, Richards T, Kolson D, Schifitto G, Jarvik JG, Miller EN, Lenkinski R, Gonzalez G, Navia BA: A multicenter in vivo proton-MRS study of HIV-associated dementia and its relationship to age. Neuroimage. 2004 Dec;23(4):1336-47. [PubMed
]
- Rysz J, Bartnicki P, Blaszczak R, Kujawski K, Cialkowska-Rysz A, Olszewski R, Markuszewski L: [Anti-inflammatory action of myoinositol in renal insufficiency] Pol Merkur Lekarski. 2006 Feb;20(116):180-3. [PubMed
]
- Lee PL, Yiannoutsos CT, Ernst T, Chang L, Marra CM, Jarvik JG, Richards TL, Kwok EW, Kolson DL, Simpson D, Tang CY, Schifitto G, Ketonen LM, Meyerhoff DJ, Lenkinski RE, Gonzalez RG, Navia BA: A multi-center 1H MRS study of the AIDS dementia complex: validation and preliminary analysis. J Magn Reson Imaging. 2003 Jun;17(6):625-33. [PubMed
]
- Galasko GT, Bao Y, Broomfield SJ, Hooper NM, Turner AJ, Larner J: Circulating factors and insulin resistance. I. A novel myoinositol 1,2-cyclic phosphate phosphoglycan insulin antagonist from human plasma is elevated in noninsulin-dependent diabetes mellitus. J Clin Endocrinol Metab. 1995 Aug;80(8):2419-29. [PubMed
]
- Shetty HU, Holloway HW, Rapoport SI: Capillary gas chromatography combined with ion trap detection for quantitative profiling of polyols in cerebrospinal fluid and plasma. Anal Biochem. 1995 Jan 1;224(1):279-85. [PubMed
]
- Yiannoutsos CT, Ernst T, Chang L, Lee PL, Richards T, Marra CM, Meyerhoff DJ, Jarvik JG, Kolson D, Schifitto G, Ellis RJ, Swindells S, Simpson DM, Miller EN, Gonzalez RG, Navia BA: Regional patterns of brain metabolites in AIDS dementia complex. Neuroimage. 2004 Nov;23(3):928-35. [PubMed
]
- Wikipedia

|
| Metabolic Enzymes |
- Alpha-galactosidase A precursor
- Inositol oxygenase
- Inositol monophosphatase
- Inositol monophosphatase 2
- MIOX protein
- Inositol monophosphatase 3
- cDNA FLJ77674, highly similar to Homo sapiens CDP-diacylglycerol-- inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) (CDIPT), transcript variant 1, mRNA (CDP-diacylglycerol--inositol 3- phosphatidyltransferase (Phosphatidylinositol syntha
- cDNA, FLJ93260, Homo sapiens inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), mRNA (Inositol(Myo)-1(Or 4)-monophosphatase 1, isoform CRA_a)
- Inositol monophosphatase 2 variant 1 (Inositol(Myo)-1(Or 4)-monophosphatase 2, isoform CRA_b)
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
5997 |
| Enzyme 1 Name |
Alpha-galactosidase A precursor |
| Enzyme 1 Synonyms |
- Melibiase
- Alpha-D- galactoside galactohydrolase
- Alpha-D-galactosidase A
- Agalsidase alfa
|
| Enzyme 1 Gene Name |
GLA |
| Enzyme 1 Protein Sequence |
>Alpha-galactosidase A precursor
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL
|
| Enzyme 1 Number of Residues |
429 |
| Enzyme 1 Molecular Weight |
48767 |
| Enzyme 1 Theoretical pI |
5.27 |
| Enzyme 1 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on glycosyl bonds
- hydrolase activity, hydrolyzing O-glycosyl compounds
|
| Process |
- carbohydrate metabolism
- macromolecule metabolism
- metabolism
- physiological process
|
| Component |
| — |
|
| Enzyme 1 General Function |
Not Available |
| Enzyme 1 Specific Function |
Hydrolysis of terminal, non-reducing alpha-D- galactose residues in alpha-D-galactosides, including galactose oligosaccharides, galactomannans and galactohydrolase |
| Enzyme 1 Pathways |
|
| Enzyme 1 Reactions |
- Hydrolysis of terminal, non-reducing alpha-D-galactose residues in alpha-D-galactosides, including galactose oligosaccharides, galactomannans and galactohydrolase
|
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
Not Available |
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
757912  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
P06280  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
AGAL_HUMAN  |
| Enzyme 1 PDB ID |
1R47  |
| Enzyme 1 PDB File |
Show |
| Enzyme 1 3D Structure |
|
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
>1290 bp
ATGCAGCTGAGGAACCCAGAACTACATCTGGGCTGCGCGCTTGCGCTTCGCTTCCTGGCC
CTCGTTTCCTGGGACATCCCTGGGGCTAGAGCACTGGACAATGGATTGGCAAGGACGCCT
ACCATGGGCTGGCTGCACTGGGAGCGCTTCATGTGCAACCTTGACTGCCAGGAAGAGCCA
GATTCCTGCATCAGTGAGAAGCTCTTCATGGAGATGGCAGAGCTCATGGTCTCAGAAGGC
TGGAAGGATGCAGGTTATGAGTACCTCTGCATTGATGACTGTTGGATGGCTCCCCAAAGA
GATTCAGAAGGCAGACTTCAGGCAGACCCTCAGCGCTTTCCTCATGGGATTCGCCAGCTA
GCTAATTATGTTCACAGCAAAGGACTGAAGCTAGGGATTTATGCAGATGTTGGAAATAAA
ACCTGCGCAGGCTTCCCTGGGAGTTTTGGATACTACGACATTGATGCCCAGACCTTTGCT
GACTGGGGAGTAGATCTGCTAAAATTTGATGGTTGTTACTGTGACAGTTTGGAAAATTTG
GCAGATGGTTATAAGCACATGTCCTTGGCCCTGAATAGGACTGGCAGAAGCATTGTGTAC
TCCTGTGAGTGGCCTCTTTATATGTGGCCCTTTCAAAAGCCCAATTATACAGAAATCCGA
CAGTACTGCAATCACTGGCGAAATTTTGCTGACATTGATGATTCCTGGAAAAGTATAAAG
AGTATCTTGGACTGGACATCTTTTAACCAGGAGAGAATTGTTGATGTTGCTGGACCAGGG
GGTTGGAATGACCCAGATATGTTAGTGATTGGCAACTTTGGCCTCAGCTGGAATCAGCAA
GTAACTCAGATGGCCCTCTGGGCTATCATGGCTGCTCCTTTATTCATGTCTAATGACCTC
CGACACATCAGCCCTCAAGCCAAAGCTCTCCTTCAGGATAAGGACGTAATTGCCATCAAT
CAGGACCCCTTGGGCAAGCAAGGGTACCAGCTTAGACAGGGAGACAACTTTGAAGTGTGG
GAACGACCTCTCTCAGGCTTAGCCTGGGCTGTAGCTATGATAAACCGGCAGGAGATTGGT
GGACCTCGCTCTTATACCATCGCAGTTGCTTCCCTGGGTAAAGGAGTGGCCTGTAATCCT
GCCTGCTTCATCACACAGCTCCTCCCTGTGAAAAGGAAGCTAGGGTTCTATGAATGGACT
TCAAGGTTAAGAAGTCACATAAATCCCACAGGCACTGTTTTGCTTCAGCTAGAAAATACA
ATGCAGATGTCATTAAAAGACTTACTTTAA
|
| Enzyme 1 GenBank Gene ID |
X05790  |
| Enzyme 1 GeneCard ID |
GLA  |
| Enzyme 1 GenAtlas ID |
GLA  |
| Enzyme 1 HGNC ID |
HGNC:4296  |
| Enzyme 1 Chromosome Location |
X |
| Enzyme 1 Locus |
Xq22 |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
- Tsuji S, Martin BM, Kaslow DC, Migeon BR, Choudary PV, Stubbleflied BK, Mayor JA, Murray GJ, Barranger JA, Ginns EI: Signal sequence and DNA-mediated expression of human lysosomal alpha-galactosidase A. Eur J Biochem. 1987 Jun 1;165(2):275-80. [PubMed
]
- Kornreich R, Desnick RJ, Bishop DF: Nucleotide sequence of the human alpha-galactosidase A gene. Nucleic Acids Res. 1989 Apr 25;17(8):3301-2. [PubMed
]
- Oeltjen JC, Liu X, Lu J, Allen RC, Muzny D, Belmont JW, Gibbs RA: Sixty-nine kilobases of contiguous human genomic sequence containing the alpha-galactosidase A and Bruton's tyrosine kinase loci. Mamm Genome. 1995 May;6(5):334-8. [PubMed
]
- Bishop DF, Calhoun DH, Bernstein HS, Hantzopoulos P, Quinn M, Desnick RJ: Human alpha-galactosidase A: nucleotide sequence of a cDNA clone encoding the mature enzyme. Proc Natl Acad Sci U S A. 1986 Jul;83(13):4859-63. [PubMed
]
- Quinn M, Hantzopoulos P, Fidanza V, Calhoun DH: A genomic clone containing the promoter for the gene encoding the human lysosomal enzyme, alpha-galactosidase A. Gene. 1987;58(2-3):177-88. [PubMed
]
- Bishop DF, Kornreich R, Desnick RJ: Structural organization of the human alpha-galactosidase A gene: further evidence for the absence of a 3' untranslated region. Proc Natl Acad Sci U S A. 1988 Jun;85(11):3903-7. [PubMed
]
- Novo FJ, Kruszewski A, MacDermot KD, Goldspink G, Gorecki DC: Editing of human alpha-galactosidase RNA resulting in a pyrimidine to purine conversion. Nucleic Acids Res. 1995 Jul 25;23(14):2636-40. [PubMed
]
- Eng CM, Desnick RJ: Molecular basis of Fabry disease: mutations and polymorphisms in the human alpha-galactosidase A gene. Hum Mutat. 1994;3(2):103-11. [PubMed
]
- Koide T, Ishiura M, Iwai K, Inoue M, Kaneda Y, Okada Y, Uchida T: A case of Fabry's disease in a patient with no alpha-galactosidase A activity caused by a single amino acid substitution of Pro-40 by Ser. FEBS Lett. 1990 Jan 1;259(2):353-6. [PubMed
]
- von Scheidt W, Eng CM, Fitzmaurice TF, Erdmann E, Hubner G, Olsen EG, Christomanou H, Kandolf R, Bishop DF, Desnick RJ: An atypical variant of Fabry's disease with manifestations confined to the myocardium. N Engl J Med. 1991 Feb 7;324(6):395-9. [PubMed
]
- Sakuraba H, Oshima A, Fukuhara Y, Shimmoto M, Nagao Y, Bishop DF, Desnick RJ, Suzuki Y: Identification of point mutations in the alpha-galactosidase A gene in classical and atypical hemizygotes with Fabry disease. Am J Hum Genet. 1990 Nov;47(5):784-9. [PubMed
]
- Bernstein HS, Bishop DF, Astrin KH, Kornreich R, Eng CM, Sakuraba H, Desnick RJ: Fabry disease: six gene rearrangements and an exonic point mutation in the alpha-galactosidase gene. J Clin Invest. 1989 Apr;83(4):1390-9. [PubMed
]
- Ishii S, Sakuraba H, Suzuki Y: Point mutations in the upstream region of the alpha-galactosidase A gene exon 6 in an atypical variant of Fabry disease. Hum Genet. 1992 Apr;89(1):29-32. [PubMed
]
- Eng CM, Resnick-Silverman LA, Niehaus DJ, Astrin KH, Desnick RJ: Nature and frequency of mutations in the alpha-galactosidase A gene that cause Fabry disease. Am J Hum Genet. 1993 Dec;53(6):1186-97. [PubMed
]
- Davies JP, Winchester BG, Malcolm S: Mutation analysis in patients with the typical form of Anderson-Fabry disease. Hum Mol Genet. 1993 Jul;2(7):1051-3. [PubMed
]
- Davies J, Christomanou H, Winchester B, Malcolm S: Detection of 8 new mutations in the alpha-galactosidase A gene in Fabry disease. Hum Mol Genet. 1994 Apr;3(4):667-9. [PubMed
]
- Eng CM, Niehaus DJ, Enriquez AL, Burgert TS, Ludman MD, Desnick RJ: Fabry disease: twenty-three mutations including sense and antisense CpG alterations and identification of a deletional hot-spot in the alpha-galactosidase A gene. Hum Mol Genet. 1994 Oct;3(10):1795-9. [PubMed
]
- Okumiya T, Ishii S, Takenaka T, Kase R, Kamei S, Sakuraba H, Suzuki Y: Galactose stabilizes various missense mutants of alpha-galactosidase in Fabry disease. Biochem Biophys Res Commun. 1995 Sep 25;214(3):1219-24. [PubMed
]
- Okumiya T, Ishii S, Kase R, Kamei S, Sakuraba H, Suzuki Y: Alpha-galactosidase gene mutations in Fabry disease: heterogeneous expressions of mutant enzyme proteins. Hum Genet. 1995 May;95(5):557-61. [PubMed
]
- Madsen KM, Hasholt L, Sorensen SA, Fermer ML, Dahl N: Two novel mutations (L32P) and (G85N) among five different missense mutations in six Danish families with Fabry's disease. Hum Mutat. 1995;5(3):277-8. [PubMed
]
- Nakao S, Takenaka T, Maeda M, Kodama C, Tanaka A, Tahara M, Yoshida A, Kuriyama M, Hayashibe H, Sakuraba H, et al.: An atypical variant of Fabry's disease in men with left ventricular hypertrophy. N Engl J Med. 1995 Aug 3;333(5):288-93. [PubMed
]
- Davies JP, Eng CM, Hill JA, Malcolm S, MacDermot K, Winchester B, Desnick RJ: Fabry disease: fourteen alpha-galactosidase A mutations in unrelated families from the United Kingdom and other European countries. Eur J Hum Genet. 1996;4(4):219-24. [PubMed
]
- Cariolou MA, Christodoulides M, Manoli P, Kokkofitou A, Tsambaos D: Novel trinucleotide deletion in Fabry's disease. Hum Genet. 1996 Apr;97(4):468-70. [PubMed
]
- Germain D, Biasotto M, Tosi M, Meo T, Kahn A, Poenaru L: Fluorescence-assisted mismatch analysis (FAMA) for exhaustive screening of the alpha-galactosidase A gene and detection of carriers in Fabry disease. Hum Genet. 1996 Dec;98(6):719-26. [PubMed
]
- Blanch LC, Meaney C, Morris CP: A sensitive mutation screening strategy for Fabry disease: detection of nine mutations in the alpha-galactosidase A gene. Hum Mutat. 1996;8(1):38-43. [PubMed
]
- Redonnet-Vernhet I, Ploos van Amstel JK, Jansen RP, Wevers RA, Salvayre R, Levade T: Uneven X inactivation in a female monozygotic twin pair with Fabry disease and discordant expression of a novel mutation in the alpha-galactosidase A gene. J Med Genet. 1996 Aug;33(8):682-8. [PubMed
]
- Takata T, Okumiya T, Hayashibe H, Shimmoto M, Kase R, Itoh K, Utsumi K, Kamei S, Sakuraba H: Screening and detection of gene mutations in Japanese patients with Fabry disease by non-radioactive single-stranded conformation polymorphism analysis. Brain Dev. 1997 Mar;19(2):111-6. [PubMed
]
- Eng CM, Ashley GA, Burgert TS, Enriquez AL, D'Souza M, Desnick RJ: Fabry disease: thirty-five mutations in the alpha-galactosidase A gene in patients with classic and variant phenotypes. Mol Med. 1997 Mar;3(3):174-82. [PubMed
]
- Miyazaki T, Kajita M, Ohmori S, Mizutani N, Niwa T, Murata Y, Seo H: A novel mutation (E358K) in the alpha-galactosidase A gene detected in a Japanese family with Fabry disease. Hum Mutat. 1998;Suppl 1:S139-40. [PubMed
]
- Okumiya T, Kawamura O, Itoh K, Kase R, Ishii S, Kamei S, Sakuraba H: Novel missense mutation (M72V) of alpha-galactosidase gene and its expression product in an atypical Fabry hemizygote. Hum Mutat. 1998;Suppl 1:S213-6. [PubMed
]
- Guffon N, Froissart R, Chevalier-Porst F, Maire I: Mutation analysis in 11 French patients with Fabry disease. Hum Mutat. 1998;Suppl 1:S288-90. [PubMed
]
- Germain DP, Poenaru L: Fabry disease: identification of novel alpha-galactosidase A mutations and molecular carrier detection by use of fluorescent chemical cleavage of mismatches. Biochem Biophys Res Commun. 1999 Apr 21;257(3):708-13. [PubMed
]
- Beyer EM, Karpova EA, Udalova OV, Ploos van Amstel JK, van Diggelen OP, Tsvetkova IV: The multiple cases of Fabry disease in a Russian family caused by an E341K amino acid substitution in the alpha-galactosidase A. Clin Chim Acta. 1999 Feb;280(1-2):81-9. [PubMed
]
- Topaloglu AK, Ashley GA, Tong B, Shabbeer J, Astrin KH, Eng CM, Desnick RJ: Twenty novel mutations in the alpha-galactosidase A gene causing Fabry disease. Mol Med. 1999 Dec;5(12):806-11. [PubMed
]
- Lee JK, Kim GH, Kim JS, Kim KK, Lee MC, Yoo HW: Identification of four novel mutations in five unrelated Korean families with Fabry disease. Clin Genet. 2000 Sep;58(3):228-33. [PubMed
]
- Ashton-Prolla P, Tong B, Shabbeer J, Astrin KH, Eng CM, Desnick RJ: Fabry disease: twenty-two novel mutations in the alpha-galactosidase A gene and genotype/phenotype correlations in severely and mildly affected hemizygotes and heterozygotes. J Investig Med. 2000 Jul;48(4):227-35. [PubMed
]
- Germain DP, Salard D, Fellmann F, Azibi K, Caillaud C, Bernard MC, Poenaru L: Identification of a novel de novo mutation (G373D) in the alpha-galactosidase A gene (GLA) in a patient affected with Fabry disease. Hum Mutat. 2001 Apr;17(4):353. [PubMed
]
- Blaydon D, Hill J, Winchester B: Fabry disease: 20 novel GLA mutations in 35 families. Hum Mutat. 2001 Nov;18(5):459. [PubMed
]
|
| Enzyme 1 Metabolite References |
Not Available |
|
Enzyme 2
[top]
|
| Enzyme 2 ID |
6121 |
| Enzyme 2 Name |
Inositol oxygenase |
| Enzyme 2 Synonyms |
- Myo-inositol oxygenase
- Aldehyde reductase-like 6
- Renal-specific oxidoreductase
- Kidney-specific protein 32
|
| Enzyme 2 Gene Name |
MIOX |
| Enzyme 2 Protein Sequence |
>Inositol oxygenase
MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKH
AQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQ
PHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDL
AMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW
|
| Enzyme 2 Number of Residues |
285 |
| Enzyme 2 Molecular Weight |
33010 |
| Enzyme 2 Theoretical pI |
5.74 |
| Enzyme 2 GO Classification |
Not Available |
| Enzyme 2 General Function |
Not Available |
| Enzyme 2 Specific Function |
Myo-inositol + O(2) = D-glucuronate + H(2)O |
| Enzyme 2 Pathways |
|
| Enzyme 2 Reactions |
- myo-inositol + O2 = D-glucuronate + H2O
|
| Enzyme 2 Pfam Domain Function |
|
| Enzyme 2 Signals |
|
| Enzyme 2 Transmembrane Regions |
|
| Enzyme 2 Essentiality |
Not Available |
| Enzyme 2 GenBank ID Protein |
17932582  |
| Enzyme 2 UniProtKB/Swiss-Prot ID |
Q9UGB7  |
| Enzyme 2 UniProtKB/Swiss-Prot Entry Name |
MIOX_HUMAN  |
| Enzyme 2 PDB ID |
Not Available |
| Enzyme 2 Cellular Location |
Not Available |
| Enzyme 2 Gene Sequence |
>858 bp
ATGAAGGTGACGGTGGGCCCAGACCCTTCCCTGGTCTACCGACCTGATGTGGACCCAGAG
GTGGCCAAAGACAAGGCCAGCTTCCGGAACTACACGTCAGGTCCCCTCCTGGACCGTGTC
TTCACCACCTACAAGCTCATGCACACGCACCAGACAGTGGACTTCGTCAGGAGCAAGCAT
GCCCAGTTTGGGGGCTTCTCCTACAAGAAAATGACAGTCATGGAGGCCGTGGACCTGCTG
GATGGGCTGGTGGATGAGTCGGACCCGGACGTAGATTTCCCCAACTCCTTCCATGCCTTC
CAGACAGCGGAGGGCATCCGGAAGGCCCACCCAGACAAGGACTGGTTCCACCTCGTCGGG
CTCCTGCACGACCTGGGGAAGGTCCTGGCCCTGTTCGGGGAGCCCCAGTGGGCTGTCGTC
GGCGACACCTTCCCCGTCGGATGCCGTCCGCAGGCCTCCGTGGTTTTCTGCGACTCCACC
TTCCAGGACAACCCTGACCTCCAGGATCCTCGATACAGCACAGAGCTCGGGATGTATCAG
CCCCACTGTGGGCTCGACAGGGTCCTCATGTCCTGGGGCCATGATGAGTACATGTACCAG
GTGATGAAGTTTAACAAGTTCTCACTGCCCCCTGAGGCTTTCTACATGATCCGGTTCCAC
TCCTTCTACCCCTGGCACACGGGCCGCGACTACCAGCAGCTGTGCAGCCAGCAGGACCTG
GCCATGCTGCCCTGGGTGCGGGAGTTCAACAAGTTCGACCTCTACACCAAGTGCCCGGAC
CTGCCGGACGTGGACAAGCTGCGGCCCTACTACCAGGGGCTCATTGACAAGTACTGCCCT
GGCATCCTGAGCTGGTGA
|
| Enzyme 2 GenBank Gene ID |
AY064416  |
| Enzyme 2 GeneCard ID |
MIOX  |
| Enzyme 2 GenAtlas ID |
MIOX  |
| Enzyme 2 HGNC ID |
HGNC:14522  |
| Enzyme 2 Chromosome Location |
22 |
| Enzyme 2 Locus |
22q13.3 |
| Enzyme 2 SNPs |
SNPJam Report  |
| Enzyme 2 General References |
- Yang Q, Dixit B, Wada J, Tian Y, Wallner EI, Srivastva SK, Kanwar YS: Identification of a renal-specific oxido-reductase in newborn diabetic mice. Proc Natl Acad Sci U S A. 2000 Aug 29;97(18):9896-901. [PubMed
]
- Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed
]
|
| Enzyme 2 Metabolite References |
Not Available |
|
Enzyme 3
[top]
|
| Enzyme 3 ID |
6145 |
| Enzyme 3 Name |
Inositol monophosphatase |
| Enzyme 3 Synonyms |
- IMPase
- IMP
- Inositol-1(or 4-monophosphatase
- Lithium-sensitive myo-inositol monophosphatase A1
|
| Enzyme 3 Gene Name |
IMPA1 |
| Enzyme 3 Protein Sequence |
>Inositol monophosphatase
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKE
KYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFG
VVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNME
KLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTG
GPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
|
| Enzyme 3 Number of Residues |
277 |
| Enzyme 3 Molecular Weight |
30189 |
| Enzyme 3 Theoretical pI |
4.91 |
| Enzyme 3 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on ester bonds
- inositol or phosphatidylinositol phosphatase activity
- phosphoric ester hydrolase activity
- phosphoric monoester hydrolase activity
|
| Process |
- carbohydrate metabolism
- macromolecule metabolism
- metabolism
- physiological process
|
| Component |
| — |
|
| Enzyme 3 General Function |
Carbohydrate transport and metabolism |
| Enzyme 3 Specific Function |
Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain |
| Enzyme 3 Pathways |
|
| Enzyme 3 Reactions |
- myo-inositol phosphate + H2O = myo-inositol + phosphate
|
| Enzyme 3 Pfam Domain Function |
|
| Enzyme 3 Signals |
|
| Enzyme 3 Transmembrane Regions |
|
| Enzyme 3 Essentiality |
Not Available |
| Enzyme 3 GenBank ID Protein |
395340  |
| Enzyme 3 UniProtKB/Swiss-Prot ID |
P29218  |
| Enzyme 3 UniProtKB/Swiss-Prot Entry Name |
IMPA1_HUMAN  |
| Enzyme 3 PDB ID |
1IMB  |
| Enzyme 3 PDB File |
Show |
| Enzyme 3 3D Structure |
|
| Enzyme 3 Cellular Location |
Not Available |
| Enzyme 3 Gene Sequence |
>834 bp
ATGGCTGATCCTTGGCAGGAATGCATGGATTATGCAGTAACTCTAGCAAGACAAGCTGGA
GAGGTAGTTTGTGAAGCTATAAAAAATGAAATGAATGTTATGCTGAAAAGTTCTCCAGTT
GATTTGGTAACTGCTACGGACCAAAAAGTTGAAAAAATGCTTATCTCTTCCATAAAGGAA
AAGTATCCATCTCACAGTTTCATTGGTGAAGAATCTGTGGCAGCTGGGGAAAAAAGTATC
TTAACCGACAACCCCACATGGATCATTGACCCTATTGATGGAACAACTAACTTTGTACAT
AGATTTCCTTTTGTAGCTGTTTCAATTGGCTTTGCTGTAAATAAAAAGATAGAATTTGGA
GTTGTGTACAGTTGTGTGGAAGGCAAGATGTACACTGCCAGAAAAGGAAAAGGGGCCTTT
TGTAATGGTCAAAAACTACAAGTTTCACAACAAGAAGATATTACCAAATCTCTCTTGGTG
ACTGAGTTGGGCTCTTCTAGAACACCAGAGACTGTGAGAATGGTTCTTTCTAATATGGAA
AAGCTTTTTTGCATTCCTGTTCATGGGATCCGGAGTGTTGGAACAGCAGCTGTTAATATG
TGCCTTGTGGCAACTGGCGGAGCAGATGCATATTATGAAATGGGAATTCACTGCTGGGAT
GTTGCAGGAGCTGGCATTATTGTTACTGAAGCTGGTGGCGTGCTAATGGATGTTACAGGT
GGACCATTTGATTTGATGTCACGAAGAGTAATTGCTGCAAATAATAGAATATTAGCAGAA
AGGATAGCTAAAGAAATTCAGGTTATACCTTTGCAACGAGACGACGAAGATTAA
|
| Enzyme 3 GenBank Gene ID |
X66922  |
| Enzyme 3 GeneCard ID |
IMPA1  |
| Enzyme 3 GenAtlas ID |
IMPA1  |
| Enzyme 3 HGNC ID |
HGNC:6050  |
| Enzyme 3 Chromosome Location |
8 |
| Enzyme 3 Locus |
8q21.13-q21.3 |
| Enzyme 3 SNPs |
SNPJam Report  |
| Enzyme 3 General References |
- McAllister G, Whiting P, Hammond EA, Knowles MR, Atack JR, Bailey FJ, Maigetter R, Ragan CI: cDNA cloning of human and rat brain myo-inositol monophosphatase. Expression and characterization of the human recombinant enzyme. Biochem J. 1992 Jun 15;284 ( Pt 3):749-54. [PubMed
]
- Sjoholt G, Molven A, Lovlie R, Wilcox A, Sikela JM, Steen VM: Genomic structure and chromosomal localization of a human myo-inositol monophosphatase gene (IMPA). Genomics. 1997 Oct 1;45(1):113-22. [PubMed
]
- Bone R, Springer JP, Atack JR: Structure of inositol monophosphatase, the putative target of lithium therapy. Proc Natl Acad Sci U S A. 1992 Nov 1;89(21):10031-5. [PubMed
]
|
| Enzyme 3 Metabolite References |
Not Available |
|
Enzyme 4
[top]
|
| Enzyme 4 ID |
6411 |
| Enzyme 4 Name |
Inositol monophosphatase 2 |
| Enzyme 4 Synonyms |
- IMPase 2
- IMP 2
- Inositol- 1(or 4-monophosphatase 2
- Myo-inositol monophosphatase A2
|
| Enzyme 4 Gene Name |
IMPA2 |
| Enzyme 4 Protein Sequence |
>Inositol monophosphatase 2
MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI
GFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDP
ATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIR
EAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
|
| Enzyme 4 Number of Residues |
288 |
| Enzyme 4 Molecular Weight |
31321 |
| Enzyme 4 Theoretical pI |
6.59 |
| Enzyme 4 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on ester bonds
- inositol or phosphatidylinositol phosphatase activity
- phosphoric ester hydrolase activity
- phosphoric monoester hydrolase activity
|
| Process |
| — |
| Component |
| — |
|
| Enzyme 4 General Function |
Carbohydrate transport and metabolism |
| Enzyme 4 Specific Function |
Myo-inositol phosphate + H(2)O = myo-inositol + phosphate |
| Enzyme 4 Pathways |
|
| Enzyme 4 Reactions |
- myo-inositol phosphate + H2O = myo-inositol + phosphate
|
| Enzyme 4 Pfam Domain Function |
|
| Enzyme 4 Signals |
|
| Enzyme 4 Transmembrane Regions |
|
| Enzyme 4 Essentiality |
Not Available |
| Enzyme 4 GenBank ID Protein |
2406666  |
| Enzyme 4 UniProtKB/Swiss-Prot ID |
O14732  |
| Enzyme 4 UniProtKB/Swiss-Prot Entry Name |
IMPA2_HUMAN  |
| Enzyme 4 PDB ID |
Not Available |
| Enzyme 4 Cellular Location |
Not Available |
| Enzyme 4 Gene Sequence |
>867 bp
ATGAAGCCGAGCGGCGAGGACCAGGCGGCGCTGGCGGCCGGCCCCTGGGAGGAGTGCTTC
CAGGCGGCCGTGCAGCTGGCGCTGCGGGCAGGACAGATCATCAGAAAAGCCCTTACTGAG
GAAAAACGTGTCTCAACAAAAACATCAGCTGCAGATCTTGTGACAGAAACAGATCACCTT
GTGGAAGATTTAATTATTTCTGAGTTGCGAGAGAGGTTTCCTTCACACAGGTTCATTGCA
GAAGAGGCCGCGGCTTCTGGGGCCAAGTGTGTGCTCACCCACAGCCCGACGTGGATCATC
GACCCCATCGACGGCACCTGCAATTTTGTGCACAGATTCCCGACTGTGGCGGTTAGCATT
GGATTTGCTGTTCGACAAGAGCTTGAATTCGGAGTGATTTACCACTGCACAGAGGAGCGG
CTGTACACGGGCCGGCGGGGTCGGGGCGCCTTCTGCAATGGCCAGCGGCTCCGGGTCTCC
GGGGAGACAGATCTCTCAAAGGCCTTGGTTCTGACAGAAATTGGCCCCAAACGTGACCCT
GCGACCCTGAAGCTGTTCCTGAGTAACATGGAGCGGCTGCTGCATGCCAAGGCGCATGGG
GTCCGAGTGATTGGAAGCTCCACATTGGCACTCTGCCACCTGGCCTCAGGGGCCGCGGAT
GCCTATTACCAGTTTGGCCTGCACTGCTGGGATCTGGCGGCTGCCACAGTCATCATCAGA
GAAGCAGGCGGCATCGTGATAGACACTTCGGGTGGACCCCTCGACCTCATGGCTTGCAGA
GTGGTTGCGGCCAGCACCCGGGAGATGGCGATGCTCATAGCTCAGGCCTTACAGACCATT
AACTATGGGCGGGATGATGAGAAGTGA
|
| Enzyme 4 GenBank Gene ID |
AF014398  |
| Enzyme 4 GeneCard ID |
IMPA2  |
| Enzyme 4 GenAtlas ID |
IMPA2  |
| Enzyme 4 HGNC ID |
HGNC:6051  |
| Enzyme 4 Chromosome Location |
18 |
| Enzyme 4 Locus |
18p11.2 |
| Enzyme 4 SNPs |
SNPJam Report  |
| Enzyme 4 General References |
- Yoshikawa T, Turner G, Esterling LE, Sanders AR, Detera-Wadleigh SD: A novel human myo-inositol monophosphatase gene, IMP.18p, maps to a susceptibility region for bipolar disorder. Mol Psychiatry. 1997 Sep;2(5):393-7. [PubMed
]
- Sjoholt G, Gulbrandsen AK, Lovlie R, Berle JO, Molven A, Steen VM: A human myo-inositol monophosphatase gene (IMPA2) localized in a putative susceptibility region for bipolar disorder on chromosome 18p11.2: genomic structure and polymorphism screening in manic-depressive patients. Mol Psychiatry. 2000 Mar;5(2):172-80. [PubMed
]
|
| Enzyme 4 Metabolite References |
Not Available |
|
Enzyme 5
[top]
|
| Enzyme 5 ID |
13064 |
| Enzyme 5 Name |
MIOX protein |
| Enzyme 5 Synonyms |
- Myo-inositol oxygenase, isoform CRA_d
- Myo-inositol oxygenase
|
| Enzyme 5 Gene Name |
MIOX |
| Enzyme 5 Protein Sequence |
>MIOX protein
MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKH
AQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKVPNLPCP
SPSQTGSTSSGSCTTWGRSWPCSGSPSGLSSATPSPSDAVRRPPWFSATPPSRTTLTSRI
LDTAQSSGCISPTVGSTGSSCPGAMMQVRPLHQVPGPAGRGQAAALLPGAH
|
| Enzyme 5 Number of Residues |
231 |
| Enzyme 5 Molecular Weight |
24516 |
| Enzyme 5 Theoretical pI |
8.23 |
| Enzyme 5 GO Classification |
Not Available |
| Enzyme 5 General Function |
Not Available |
| Enzyme 5 Specific Function |
Not Available |
| Enzyme 5 Pathways |
Not Available |
| Enzyme 5 Reactions |
Not Available |
| Enzyme 5 Pfam Domain Function |
|
| Enzyme 5 Signals |
|
| Enzyme 5 Transmembrane Regions |
|
| Enzyme 5 Essentiality |
Not Available |
| Enzyme 5 GenBank ID Protein |
116283362  |
| Enzyme 5 UniProtKB/Swiss-Prot ID |
Q05DJ6  |
| Enzyme 5 UniProtKB/Swiss-Prot Entry Name |
Q05DJ6_HUMAN  |
| Enzyme 5 PDB ID |
Not Available |
| Enzyme 5 Cellular Location |
Not Available |
| Enzyme 5 Gene Sequence |
Not Available |
| Enzyme 5 GenBank Gene ID |
BC012025  |
| Enzyme 5 GeneCard ID |
Q05DJ6  |
| Enzyme 5 GenAtlas ID |
MIOX  |
| Enzyme 5 HGNC ID |
HGNC:14522  |
| Enzyme 5 Chromosome Location |
Not Available |
| Enzyme 5 Locus |
Not Available |
| Enzyme 5 SNPs |
SNPJam Report  |
| Enzyme 5 General References |
- Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed
]
|
| Enzyme 5 Metabolite References |
Not Available |
|
Enzyme 6
[top]
|
| Enzyme 6 ID |
14455 |
| Enzyme 6 Name |
Inositol monophosphatase 3 |
| Enzyme 6 Synonyms |
- IMPase 3
- IMP 3
- Inositol- 1(or 4-monophosphatase 3
- Myo-inositol monophosphatase A3
- Inositol monophosphatase domain-containing protein 1
|
| Enzyme 6 Gene Name |
IMPAD1 |
| Enzyme 6 Protein Sequence |
>Inositol monophosphatase 3
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
|
| Enzyme 6 Number of Residues |
359 |
| Enzyme 6 Molecular Weight |
38682 |
| Enzyme 6 Theoretical pI |
6.86 |
| Enzyme 6 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on ester bonds
- inositol or phosphatidylinositol phosphatase activity
- phosphoric ester hydrolase activity
- phosphoric monoester hydrolase activity
|
| Process |
| — |
| Component |
| — |
|
| Enzyme 6 General Function |
Inorganic ion transport and metabolism |
| Enzyme 6 Specific Function |
Myo-inositol phosphate + H(2)O = myo-inositol + phosphate |
| Enzyme 6 Pathways |
|
| Enzyme 6 Reactions |
- myo-inositol phosphate + H2O = myo-inositol + phosphate [RN:R07343] ALL_REAC R07343 > R01185 R01186 R01187
|
| Enzyme 6 Pfam Domain Function |
|
| Enzyme 6 Signals |
|
| Enzyme 6 Transmembrane Regions |
|
| Enzyme 6 Essentiality |
Not Available |
| Enzyme 6 GenBank ID Protein |
7020510  |
| Enzyme 6 UniProtKB/Swiss-Prot ID |
Q9NX62  |
| Enzyme 6 UniProtKB/Swiss-Prot Entry Name |
IMPA3_HUMAN  |
| Enzyme 6 PDB ID |
Not Available |
| Enzyme 6 Cellular Location |
Not Available |
| Enzyme 6 Gene Sequence |
>1080 bp
ATGGCCCCCATGGGCATCCGCCTTTCCCCACTGGGGGTGGCAGTGTTTTGTCTGCTGGGG
CTCGGCGTGCTCTACCACCTCTACTCGGGCTTCTTGGCCGGCCGCTTCAGCCTCTTCGGC
CTGGGCGGCGAGCCTGGCGGCGGCGCGGCGGGGCCCGCGGCCGCGGCCGATGGGGGCACC
GTGGACTTGCGCGAGATGCTGGCTGTGTCAGTGCTGGCCGCAGTCCGCGGCGGCGACGAG
GTGAGGCGCGTCCGCGAGAGCAACGTCCTCCACGAGAAGTCCAAGGGGAAGACGCGCGAG
GGAGCCGAGGACAAGATGACCAGCGGCGACGTGCTGTCCAACCGCAAGATGTTCTACCTG
CTCAAGACCGCCTTCCCCAGCGTCCAGATTAATACTGAGGAACACGTGGATGCAGCTGAT
CAGGAGGTTATCTTGTGGGATCATAAGATTCCTGAGGATATCCTAAAGGAAGTAACTACT
CCTAAAGAGGTACCAGCAGAAAGTGTTACTGTCTGGATTGACCCACTTGATGCTACACAG
GAATATACAGAGGATCTTCGAAAGTACGTCACTACTATGGTGTGTGTGGCTGTAAATGGT
AAACCCATGCTAGGAGTTATACATAAGCCATTTTCCGAATATACAGCTTGGGCAATGGTA
GATGGTGGTTCAAATGTGAAAGCCCGCTCTTCCTACAATGAGAAGACCCCAAGGATCGTT
GTGTCTCGTTCCCATTCAGGGATGGTCAAACAGGTCGCTCTTCAGACTTTTGGAAACCAG
ACTACAATTATCCCAGCTGGTGGTGCTGGTTATAAAGTTTTAGCACTTTTGGATGTGCCT
GATAAGAGTCAAGAAAAAGCTGATTTATACATCCATGTGACATACATCAAAAAGTGGGAT
ATATGTGCTGGTAATGCCATCTTAAAAGCCCTAGGGGGGCATATGACTACCCTGAGTGGT
GAAGAAATCAGTTACACTGGTTCAGACGGCATTGAAGGGGGACTCCTTGCTAGCATCAGA
ATGAACCACCAGGCCCTGGTCAGAAAACTCCCAGATCTAGAAAAGACAGGACATAAATGA
|
| Enzyme 6 GenBank Gene ID |
AK000428  |
| Enzyme 6 GeneCard ID |
Q9NX62  |
| Enzyme 6 GenAtlas ID |
IMPAD1  |
| Enzyme 6 HGNC ID |
HGNC:26019  |
| Enzyme 6 Chromosome Location |
Not Available |
| Enzyme 6 Locus |
Not Available |
| Enzyme 6 SNPs |
SNPJam Report  |
| Enzyme 6 General References |
Not Available |
| Enzyme 6 Metabolite References |
Not Available |
|
Enzyme 7
[top]
|
| Enzyme 7 ID |
15204 |
| Enzyme 7 Name |
cDNA FLJ77674, highly similar to Homo sapiens CDP-diacylglycerol-- inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) (CDIPT), transcript variant 1, mRNA (CDP-diacylglycerol--inositol 3- phosphatidyltransferase (Phosphatidylinositol syntha |
| Enzyme 7 Synonyms |
Not Available |
| Enzyme 7 Gene Name |
CDIPT |
| Enzyme 7 Protein Sequence |
>cDNA FLJ77674, highly similar to Homo sapiens CDP-diacylglycerol-- inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) (CDIPT), transcript variant 1, mRNA (CDP-diacylglycerol--inositol 3- phosphatidyltransferase (Phosphatidylinositol synthase), isoform CRA_a)
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQG
TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESH
KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTA
PIALLKSLISVIHLITAARNMAALDAADRAKKK
|
| Enzyme 7 Number of Residues |
213 |
| Enzyme 7 Molecular Weight |
23539 |
| Enzyme 7 Theoretical pI |
8.13 |
| Enzyme 7 GO Classification |
Not Available |
| Enzyme 7 General Function |
Lipid transport and metabolism |
| Enzyme 7 Specific Function |
Not Available |
| Enzyme 7 Pathways |
Not Available |
| Enzyme 7 Reactions |
Not Available |
| Enzyme 7 Pfam Domain Function |
Not Available |
| Enzyme 7 Signals |
|
| Enzyme 7 Transmembrane Regions |
|
| Enzyme 7 Essentiality |
Not Available |
| Enzyme 7 GenBank ID Protein |
158254696  |
| Enzyme 7 UniProtKB/Swiss-Prot ID |
A8K3L7  |
| Enzyme 7 UniProtKB/Swiss-Prot Entry Name |
A8K3L7_HUMAN  |
| Enzyme 7 PDB ID |
Not Available |
| Enzyme 7 Cellular Location |
Not Available |
| Enzyme 7 Gene Sequence |
>642 bp
ATGCCAGACGAAAATATCTTCCTGTTCGTGCCCAACCTCATCGGTTATGCCCGGATTGTC
TTCGCCATCATTTCTTTCTACTTCATGCCCTGCTGCCCCCTCACGGCCTCCTCCTTCTAC
CTGCTCAGCGGCCTGCTGGACGCTTTCGATGGACACGCTGCTCGCGCTCTTAATCAAGGA
ACCCGGTTTGGGGCCATGCTGGACATGCTGACGGACCGCTGCTCCACCATGTGCCTGTTG
GTCAACCTGGCCCTGCTGTACCCTGGAGCCACGCTGTTCTTCCAAATCAGCATGAGTTTG
GATGTGGCCAGTCACTGGCTGCACCTCCACAGTTCTGTGGTCCGAGGCAGTGAGAGTCAC
AAGATGATCGACTTGTCCGGGAATCCGGTGCTTCGGATCTACTACACCTCGAGGCCTGCT
CTGTTCACCTTGTGTGCTGGGAATGAGCTCTTCTACTGCCTCCTCTACCTGTTCCATTTC
TCTGAGGGACCTTTAGTTGGCTCTGTGGGACTGTTCCGGATGGGCCTCTGGGTCACTGCC
CCCATCGCCTTGCTGAAGTCGCTCATCAGCGTCATCCACCTGATCACGGCCGCCCGCAAC
ATGGCTGCCCTGGACGCAGCAGACCGCGCCAAGAAGAAGTGA
|
| Enzyme 7 GenBank Gene ID |
AK290632  |
| Enzyme 7 GeneCard ID |
A8K3L7  |
| Enzyme 7 GenAtlas ID |
Not Available |
| Enzyme 7 HGNC ID |
Not Available |
| Enzyme 7 Chromosome Location |
16 |
| Enzyme 7 Locus |
16p11.2 |
| Enzyme 7 SNPs |
SNPJam Report  |
| Enzyme 7 General References |
Not Available |
| Enzyme 7 Metabolite References |
Not Available |
|
Enzyme 8
[top]
|
| Enzyme 8 ID |
16514 |
| Enzyme 8 Name |
cDNA, FLJ93260, Homo sapiens inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), mRNA (Inositol(Myo)-1(Or 4)-monophosphatase 1, isoform CRA_a) |
| Enzyme 8 Synonyms |
Not Available |
| Enzyme 8 Gene Name |
IMPA1 |
| Enzyme 8 Protein Sequence |
>cDNA, FLJ93260, Homo sapiens inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), mRNA (Inositol(Myo)-1(Or 4)-monophosphatase 1, isoform CRA_a)
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKE
KYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFG
VVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNME
KLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTG
GPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
|
| Enzyme 8 Number of Residues |
277 |
| Enzyme 8 Molecular Weight |
30189 |
| Enzyme 8 Theoretical pI |
4.91 |
| Enzyme 8 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on ester bonds
- inositol or phosphatidylinositol phosphatase activity
- phosphoric ester hydrolase activity
- phosphoric monoester hydrolase activity
|
| Process |
| — |
| Component |
| — |
|
| Enzyme 8 General Function |
Carbohydrate transport and metabolism |
| Enzyme 8 Specific Function |
Not Available |
| Enzyme 8 Pathways |
Not Available |
| Enzyme 8 Reactions |
Not Available |
| Enzyme 8 Pfam Domain Function |
|
| Enzyme 8 Signals |
|
| Enzyme 8 Transmembrane Regions |
|
| Enzyme 8 Essentiality |
Not Available |
| Enzyme 8 GenBank ID Protein |
Not Available |
| Enzyme 8 UniProtKB/Swiss-Prot ID |
B2R733  |
| Enzyme 8 UniProtKB/Swiss-Prot Entry Name |
B2R733_HUMAN  |
| Enzyme 8 PDB ID |
1IMB  |
| Enzyme 8 PDB File |
Show |
| Enzyme 8 3D Structure |
|
| Enzyme 8 Cellular Location |
Not Available |
| Enzyme 8 Gene Sequence |
Not Available |
| Enzyme 8 GenBank Gene ID |
AK312823  |
| Enzyme 8 GeneCard ID |
B2R733  |
| Enzyme 8 GenAtlas ID |
Not Available |
| Enzyme 8 HGNC ID |
Not Available |
| Enzyme 8 Chromosome Location |
Not Available |
| Enzyme 8 Locus |
Not Available |
| Enzyme 8 SNPs |
SNPJam Report  |
| Enzyme 8 General References |
Not Available |
| Enzyme 8 Metabolite References |
Not Available |
|
Enzyme 9
[top]
|
| Enzyme 9 ID |
16515 |
| Enzyme 9 Name |
Inositol monophosphatase 2 variant 1 (Inositol(Myo)-1(Or 4)-monophosphatase 2, isoform CRA_b) |
| Enzyme 9 Synonyms |
Not Available |
| Enzyme 9 Gene Name |
IMPA2 |
| Enzyme 9 Protein Sequence |
>Inositol monophosphatase 2 variant 1 (Inositol(Myo)-1(Or 4)-monophosphatase 2, isoform CRA_b)
MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI
GFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDP
ATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIR
EAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
|
| Enzyme 9 Number of Residues |
288 |
| Enzyme 9 Molecular Weight |
31321 |
| Enzyme 9 Theoretical pI |
6.59 |
| Enzyme 9 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on ester bonds
- inositol or phosphatidylinositol phosphatase activity
- phosphoric ester hydrolase activity
- phosphoric monoester hydrolase activity
|
| Process |
| — |
| Component |
| — |
|
| Enzyme 9 General Function |
Carbohydrate transport and metabolism |
| Enzyme 9 Specific Function |
Not Available |
| Enzyme 9 Pathways |
Not Available |
| Enzyme 9 Reactions |
Not Available |
| Enzyme 9 Pfam Domain Function |
|
| Enzyme 9 Signals |
|
| Enzyme 9 Transmembrane Regions |
|
| Enzyme 9 Essentiality |
Not Available |
| Enzyme 9 GenBank ID Protein |
Not Available |
| Enzyme 9 UniProtKB/Swiss-Prot ID |
B0YJ29  |
| Enzyme 9 UniProtKB/Swiss-Prot Entry Name |
B0YJ29_HUMAN  |
| Enzyme 9 PDB ID |
Not Available |
| Enzyme 9 Cellular Location |
Not Available |
| Enzyme 9 Gene Sequence |
Not Available |
| Enzyme 9 GenBank Gene ID |
EF444990  |
| Enzyme 9 GeneCard ID |
B0YJ29  |
| Enzyme 9 GenAtlas ID |
Not Available |
| Enzyme 9 HGNC ID |
Not Available |
| Enzyme 9 Chromosome Location |
18 |
| Enzyme 9 Locus |
18p11.2 |
| Enzyme 9 SNPs |
SNPJam Report  |
| Enzyme 9 General References |
Not Available |
| Enzyme 9 Metabolite References |
Not Available |