| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2009-05-05 20:57:46 |
| Accession Number |
HMDB00218 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
Orotidylic acid |
| Description |
Orotidylic acid (OMP), is a pyrimidine nucleotide which is the last intermediate in the biosynthesis of uridine monophosphate. Decarboxylation by Orotidylate decarboxylase affords Uridine 5'-phosphate which is the route to Uridine and its derivatives de novo and consequently one of the most important processes in nucleic acid synthesis (Dictionary of Organic Compounds). In humans, the enzyme UMP synthase converts OMP into uridine 5'- monophosphate. If UMP synthase is defective, orotic aciduria can result. (Wikipedia) |
| Synonyms |
- 5'-OMP
- OMP
- Ometoprim
- Orotidine 5'-monophosphate
- Orotidine 5'-phosphate
- Orotidine monophosphate
- Orotidylate
- Orotidylic acid
- 6-carboxy-5'-uridylic acid
- 6-carboxy-5'-uridylate
- 5-(Dihydrogen phosphate)orotidine
- 5'-(dihydrogen phosphate) Orotidine
- 5'-phosphate Orotidine
- orotidine-5'-phosphate
- 5'-(dihydrogen phosphate) 6-carboxy-uridine
- Omp (nucleotide)
- orotidine 5'-(dihydrogen phosphate)
- 1,2,3,6-tetrahydro-2,6-dioxo-3-(5-O-phosphono-b-D-ribofuranosyl)-4-Pyrimidinecarboxylic acid
- 1,2,3,6-tetrahydro-2,6-dioxo-3-(5-O-phosphono-beta-delta-ribofuranosyl)-4-Pyrimidinecarboxylic acid
- 1,2,3,6-tetrahydro-2,6-dioxo-3-(5-O-phosphono-b-D-ribofuranosyl)-4-Pyrimidinecarboxylate
- 1,2,3,6-tetrahydro-2,6-dioxo-3-(5-O-phosphono-beta-delta-ribofuranosyl)-4-Pyrimidinecarboxylate
- 2,6-dioxo-3-(5-O-phosphono-beta-D-ribofuranosyl)-1,2,3,6-tetrahydropyrimidine-4-carboxylic acid
- 2,6-dioxo-3-(5-O-phosphono-beta-delta-ribofuranosyl)-1,2,3,6-tetrahydropyrimidine-4-carboxylic acid
|
| Chemical IUPAC Name |
3-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(phosphonooxymethyl)oxolan-2-yl]-2,6-dioxopyrimidine-4-carboxylic acid |
| Chemical Formula |
C10H13N2O11P |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Nucleosides and Nucleoside conjugates
|
| Class |
|
| Sub Class |
- Nucleotide monophosphates
|
| Family |
|
| Species |
- secondary alcohol
- 1,2-diol
- carboxylic acid
- oxo(het)arene
- phosphoric acid ester
- aromatic compound
- heterocyclic compound
|
| Biofunction |
- Component of Pyrimidine metabolism
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
368.191 |
| Monoisotopic Molecular Weight |
368.025696 |
| Isomeric SMILES |
O[C@H]1[C@@H](O)[C@@H](O[C@@H]1COP(O)(O)=O)N1C(=O)NC(=O)C=C1C(O)=O |
| Canonical SMILES |
OC1C(O)C(OC1COP(O)(O)=O)N1C(=O)NC(=O)C=C1C(O)=O |
| KEGG Compound ID |
C01103  |
| BioCyc ID |
OROTIDINE-5-PHOSPHATE  |
| BiGG ID |
36813  |
| Wikipedia Link |
Orotidylic acid  |
| NuGOwiki Link |
HMDB00218  |
| Metagene Link |
HMDB00218  |
| METLIN ID |
5228  |
| PubChem Compound |
160617  |
| PubChem Substance |
824464  |
| ChEBI ID |
15842  |
| CAS Registry Number |
2149-82-8 |
| InChI Identifier |
InChI=1/C10H13N2O11P/c13-5-1-3(9(16)17)12(10(18)11-5)8-7(15)6(14)4(23-8)2-22-24(19,20)21/h1,4,6-8,14-15H,2H2,(H,16,17)(H,11,13,18)(H2,19,20,21)/t4-,6-,7-,8-/m1/s1 |
| Synthesis Reference |
Ueda, Tohru; Yamamoto, Miyako; Yamane, Akira; Imazawa, Masaoki; Inoue, Hideo. Nucleosides and nucleotides. XXIII. Conversion of uridine nucleotides to the 6-cyano derivatives: synthesis of orotidylic acid. Journal of Carbohydrates, Nucleosides, Nucleotides (1978), 5(3), 261-71. |
| Melting Point (Experimental) |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
8.61 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
-3 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
-4.1 [Predicted by PubChem via XLOGP]; -1.67 [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Not Available |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Not Available |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
Not Available |
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
|
| Biofluid Location |
|
| Tissue Location |
Not Available |
| Concentrations (Normal) |
Not Available |
| Concentrations (Abnormal) |
| Biofluid |
Prostate Tissue |
| Value |
0.5 (0.0-1.0) umol/gr tissue |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Condition |
Prostate cancer |
| Comments |
Estimated concentration |
| References |
- Sreekumar A, Poisson LM, Rajendiran TM, Khan AP, Cao Q, Yu J, Laxman B, Mehra R, Lonigro RJ, Li Y, Nyati MK, Ahsan A, Kalyana-Sundaram S, Han B, Cao X, Byun J, Omenn GS, Ghosh D, Pennathur S, Alexander DC, Berger A, Shuster JR, Wei JT, Varambally S, Beecher C, Chinnaiyan AM: Metabolomic profiles delineate potential role for sarcosine in prostate cancer progression. Nature. 2009 Feb 12;457(7231):910-4. [PubMed
]
|
|
| Associated Disorders |
| Condition |
References |
| Prostate cancer |
- Sreekumar A, Poisson LM, Rajendiran TM, Khan AP, Cao Q, Yu J, Laxman B, Mehra R, Lonigro RJ, Li Y, Nyati MK, Ahsan A, Kalyana-Sundaram S, Han B, Cao X, Byun J, Omenn GS, Ghosh D, Pennathur S, Alexander DC, Berger A, Shuster JR, Wei JT, Varambally S, Beecher C, Chinnaiyan AM: Metabolomic profiles delineate potential role for sarcosine in prostate cancer progression. Nature. 2009 Feb 12;457(7231):910-4. [PubMed
]
|
|
| OMIM ID |
|
| Pathways |
|
| General References |
- Traut TW: Uridine-5'-phosphate synthase: evidence for substrate cycling involving this bifunctional protein. Arch Biochem Biophys. 1989 Jan;268(1):108-15. [PubMed
]
- Wikipedia

|
| Metabolic Enzymes |
- cDNA FLJ75687, highly similar to Homo sapiens uridine monophosphate synthetase
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
13096 |
| Enzyme 1 Name |
cDNA FLJ75687, highly similar to Homo sapiens uridine monophosphate synthetase |
| Enzyme 1 Synonyms |
- orotate phosphoribosyl transferase and orotidine-5'- decarboxylase
- UMPS, mRNA
- Uridine monophosphate synthetase
- Orotate phosphoribosyl transferase and orotidine-5'-decarboxylase, isoform CRA_b
|
| Enzyme 1 Gene Name |
UMPS |
| Enzyme 1 Protein Sequence |
>cDNA FLJ75687, highly similar to Homo sapiens uridine monophosphate synthetase
MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
|
| Enzyme 1 Number of Residues |
480 |
| Enzyme 1 Molecular Weight |
52222 |
| Enzyme 1 Theoretical pI |
7.26 |
| Enzyme 1 GO Classification |
Not Available |
| Enzyme 1 General Function |
Nucleotide transport and metabolism |
| Enzyme 1 Specific Function |
Not Available |
| Enzyme 1 Pathways |
Not Available |
| Enzyme 1 Reactions |
Not Available |
| Enzyme 1 Pfam Domain Function |
Not Available |
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
|
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
158256048  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
A8K5J1  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
A8K5J1_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
Not Available |
| Enzyme 1 GenBank Gene ID |
AK291306  |
| Enzyme 1 GeneCard ID |
A8K5J1  |
| Enzyme 1 GenAtlas ID |
Not Available |
| Enzyme 1 HGNC ID |
Not Available |
| Enzyme 1 Chromosome Location |
Not Available |
| Enzyme 1 Locus |
Not Available |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
Not Available |
| Enzyme 1 Metabolite References |
Not Available |