We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for Hydroxypropionic acid (HMDB00700)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2005-11-16 15:48:42
Update Date 2010-07-13 12:10:31
Accession Number HMDB00700
Secondary Accession Numbers Not Available
Common Name Hydroxypropionic acid
Description 3-Hydroxypropionic acid is a carboxylic acid. It is used in the production of various chemicals such as acrylates in industry. It can be produced by certain microbes . Its chemical structure is similar to L-serine.
Synonyms
  1. 2-Deoxyglycerate
  2. 2-Deoxyglyceric acid
  3. 3-Hydroxypropanoate
  4. 3-Hydroxypropanoic acid
  5. 3-Hydroxypropionate
  6. 3-Hydroxypropionic acid
  7. Ethylenelactate
  8. Ethylenelactic acid
  9. Hydracrylic acid
  10. Hydroxypropionate
  11. b-Hydroxypropionate
  12. b-Hydroxypropionic acid
  13. b-Lactate
  14. b-Lactic acid
  15. beta-Hydroxypropionate
  16. beta-Hydroxypropionic acid
  17. beta-Lactate
  18. beta-Lactic acid
Chemical IUPAC Name 3-hydroxy-propanoic acid
Chemical Formula C3H6O3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Hydroxy Acids
  • Fatty Acids
Sub Class
  • Short chain hydroxy acids
Family
  • Mammalian Metabolite
Species
  • primary alcohol
  • carboxylic acid
Biofunction
—
Application
—
Source
  • Endogenous
Average Molecular Weight 90.078
Monoisotopic Molecular Weight 90.031693
Isomeric SMILES OCCC(O)=O
Canonical SMILES OCCC(O)=O
KEGG Compound ID C01013 Link Image
BioCyc ID Not Available
BiGG ID 53188 Link Image
Wikipedia Link Hydroxypropionic acid Link Image
NuGOwiki Link HMDB00700 Link Image
Metagene Link HMDB00700 Link Image
METLIN ID 5668 Link Image
PubChem Compound 68152 Link Image
PubChem Substance 8191883 Link Image
ChEBI ID 16510 Link Image
CAS Registry Number 503-66-2
InChI Identifier InChI=1/C3H6O3/c4-2-1-3(5)6/h4H,1-2H2,(H,5,6)
Synthesis Reference Suthers, Patrick F.; Cameron, Douglas C. Production of 3-hydroxypropionic acid in recombinant organisms. PCT Int. Appl. (2001), 63 pp.
Melting Point (Experimental) <25oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 1000.0 mg/mL [MEYLAN,WM et al. (1996)]; 647.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Liquid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.95 [Predicted by ALOGPS]; -1 [Predicted by PubChem via XLOGP]; -0.89 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
Biofluid Location
  • Blood
  • Cerebrospinal Fluid
  • Urine
Tissue Location Not Available
Concentrations (Normal)
Biofluid Blood
Value 2.3 (0.0-4.0) uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Hoffmann GF, Meier-Augenstein W, Stockler S, Surtees R, Rating D, Nyhan WL: Physiology and pathophysiology of organic acids in cerebrospinal fluid. J Inherit Metab Dis. 1993;16(4):648-69. [PubMed Link Image]
Biofluid CSF
Value 4.4 +/- 4.4 uM
Age Adult:>18 yrs old
Sex
Patient information Normal
Comments Not Available
References
  • Hoffmann GF, Meier-Augenstein W, Stockler S, Surtees R, Rating D, Nyhan WL: Physiology and pathophysiology of organic acids in cerebrospinal fluid. J Inherit Metab Dis. 1993;16(4):648-69. [PubMed Link Image]
Biofluid Urine
Value 11.2 (3.4-33.6) umol/mmol creatinine
Age Newborn:0-30 days old
Sex Both
Patient information Normal
Comments Not Available
References
  • Guneral F, Bachmann C: Age-related reference values for urinary organic acids in a healthy Turkish pediatric population. Clin Chem. 1994 Jun;40(6):862-6. [PubMed Link Image]
Biofluid Urine
Value 13.8 (0.1-48.0) umol/mmol creatinine
Age Infant:0-1 yr old
Sex Both
Patient information Normal
Comments Not Available
References
  • Guneral F, Bachmann C: Age-related reference values for urinary organic acids in a healthy Turkish pediatric population. Clin Chem. 1994 Jun;40(6):862-6. [PubMed Link Image]
Biofluid Urine
Value 8.3 (2.3-18.3) umol/mmol creatinine
Age Children:1-13 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Guneral F, Bachmann C: Age-related reference values for urinary organic acids in a healthy Turkish pediatric population. Clin Chem. 1994 Jun;40(6):862-6. [PubMed Link Image]
Biofluid Urine
Value 6.1 (1.5-26.1) umol/mmol creatinine
Age Adolescent:13-18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Guneral F, Bachmann C: Age-related reference values for urinary organic acids in a healthy Turkish pediatric population. Clin Chem. 1994 Jun;40(6):862-6. [PubMed Link Image]
Biofluid Urine
Value 6.5 (3.0-10.0) umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
Concentrations (Abnormal)
Biofluid Urine
Value 260.0 (20.0-500.0) umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Condition Biotinidase deficiency
Comments Not Available
References
Biofluid Urine
Value 1000.00 (20.00-2000.00) umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Condition Propionic acidemia
Comments Not Available
References
Associated Disorders
Condition References
Biotinidase deficiency
Propionic acidemia
OMIM ID
Pathways
Name SMPDB Link KEGG Link
Propanoate Metabolism SMP00016 Link Image map00640 Link Image
General References
  1. Guneral F, Bachmann C: Age-related reference values for urinary organic acids in a healthy Turkish pediatric population. Clin Chem. 1994 Jun;40(6):862-6. [PubMed Link Image]
  2. Sweetman L, Bates SP, Hull D, Nyhan WL: Propionyl-CoA carboxylase deficiency in a patient with biotin-responsive 3-methylcrotonylglycinuria. Pediatr Res. 1977 Nov;11(11):1144-7. [PubMed Link Image]
  3. Pollitt RJ, Fowler B, Sardharwalla IB, Edwards MA, Gray RG: Increased excretion of propan-1,3-diol and 3-hydroxypropionic acid apparently caused by abnormal bacterial metabolism in the gut. Clin Chim Acta. 1987 Nov 16;169(2-3):151-7. [PubMed Link Image]
  4. Hoffmann GF, Meier-Augenstein W, Stockler S, Surtees R, Rating D, Nyhan WL: Physiology and pathophysiology of organic acids in cerebrospinal fluid. J Inherit Metab Dis. 1993;16(4):648-69. [PubMed Link Image]
  5. Brown GK, Cromby CH, Manning NJ, Pollitt RJ: Urinary organic acids in succinic semialdehyde dehydrogenase deficiency: evidence of alpha-oxidation of 4-hydroxybutyric acid, interaction of succinic semialdehyde with pyruvate dehydrogenase and possible secondary inhibition of mitochondrial beta-oxidation. J Inherit Metab Dis. 1987;10(4):367-75. [PubMed Link Image]
  6. Wikipedia Link Image
Metabolic Enzymes
  1. 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial precursor
Enzyme 1 [top]
Enzyme 1 ID 10303
Enzyme 1 Name 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial precursor
Enzyme 1 Synonyms
  1. 3-hydroxyisobutyryl-coenzyme A hydrolase
  2. HIBYL-CoA-H
  3. HIB-CoA hydrolase
Enzyme 1 Gene Name HIBCH
Enzyme 1 Protein Sequence >3-hydroxyisobutyryl-CoA hydrolase, mitochondrial precursor 
MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLEKKGCTGVITLNRPKFLNAL
TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTEEDLNNHFKSLGSSDLKF
Enzyme 1 Number of Residues 386
Enzyme 1 Molecular Weight 43483
Enzyme 1 Theoretical pI Not Available
Enzyme 1 GO Classification
Function
  • catalytic activity
Process
  • metabolism
  • physiological process
Component
—
Enzyme 1 General Function Lipid transport and metabolism
Enzyme 1 Specific Function Hydrolyzes 3-hydroxyisobutyryl-CoA (HIBYL-CoA), a saline catabolite. Has high activity toward isobutyryl-CoA. Could be an isobutyryl-CoA dehydrogenase that functions in valine catabolism. Also hydrolyzes 3-hydroxypropanoyl-CoA
Enzyme 1 Pathways
Enzyme 1 Reactions
  • 3-Hydroxypropionyl-CoA + H2O --> 3-Hydroxypropanoate + Coenzyme A + H+
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 3320120 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q6NVY1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name HIBCH_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence Not Available
Enzyme 1 GenBank Gene ID U66669 Link Image
Enzyme 1 GeneCard ID Not Available
Enzyme 1 GenAtlas ID HIBCH Link Image
Enzyme 1 HGNC ID HGNC:4908 Link Image
Enzyme 1 Chromosome Location Not Available
Enzyme 1 Locus Not Available
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. Hawes JW, Jaskiewicz J, Shimomura Y, Huang B, Bunting J, Harper ET, Harris RA: Primary structure and tissue-specific expression of human beta-hydroxyisobutyryl-coenzyme A hydrolase. J Biol Chem. 1996 Oct 18;271(42):26430-4. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available