| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2010-05-10 16:23:16 |
| Accession Number |
HMDB00716 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
L-Pipecolic acid |
| Description |
L-Pipecolic acid is a normal human metabolite present in human blood, where is present as the primary enantiomer of pipecolic acid. L-Pipecolic acid is a cyclic imino acid produced during the degradation of lysine, accumulates in body fluids of infants with generalized genetic peroxisomal disorders, including Zellweger syndrome (OMIM 214100), neonatal adrenoleukodystrophy (OMIM 202370), and infantile Refsum disease (OMIM 266510). L-Pipecolic acid levels are also elevated in patients with chronic liver diseases. L-Pipecolic acid is the substrate of delta1-piperideine-2-carboxylate reductase [EC 1.5.1.21] in the pathway of lysine degradation. (PMID: 2717271, 8305590, 1050990) |
| Synonyms |
- (-)-Pipecolate
- (-)-Pipecolic acid
- (S)-(-)-2-Piperidinecarboxylate
- (S)-(-)-2-Piperidinecarboxylic acid
- (S)-(-)-Pipecolate
- (S)-(-)-Pipecolic acid
- (S)-2-Piperidinecarboxylate
- (S)-2-Piperidinecarboxylic acid
- (S)-Pipecolate
- (S)-Pipecolic acid
- (S)-Pipecolinate
- (S)-Pipecolinic acid
- (S)-Piperidine-2-carboxylate
- (S)-Piperidine-2-carboxylic acid
- L-(-)-Pipecolate
- L-(-)-Pipecolic acid
- L-Homoproline
- L-Pipecolate
- L-Pipecolic acid
- L-Pipecolinate
- L-Pipecolinic acid
- L-Piperidine-2-carboxylate
- L-Piperidine-2-carboxylic acid
|
| Chemical IUPAC Name |
(2S)-piperidine-2-carboxylic acid |
| Chemical Formula |
C6H11NO2 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Amino acids and Amino Acid conjugates
|
| Class |
|
| Sub Class |
|
| Family |
|
| Species |
- secondary amine
- secondary aliphatic amine (dialkylamine)
- carboxylic acid
- heterocyclic compound
- alpha-aminoacid
|
| Biofunction |
- Protein synthesis, amino acid biosynthesis
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
129.157 |
| Monoisotopic Molecular Weight |
129.078979 |
| Isomeric SMILES |
OC(=O)[C@@H]1CCCCN1 |
| Canonical SMILES |
OC(=O)C1CCCCN1 |
| KEGG Compound ID |
C00408  |
| BioCyc ID |
L-PIPECOLATE  |
| BiGG ID |
34890  |
| Wikipedia Link |
Not Available |
| NuGOwiki Link |
HMDB00716  |
| Metagene Link |
HMDB00716  |
| METLIN ID |
5684  |
| PubChem Compound |
439227  |
| PubChem Substance |
26744347  |
| ChEBI ID |
30913  |
| CAS Registry Number |
3105-95-1 |
| InChI Identifier |
InChI=1/C6H11NO2/c8-6(9)5-3-1-2-4-7-5/h5,7H,1-4H2,(H,8,9)/t5-/m0/s1 |
| Synthesis Reference |
Kisfaludy, Lajos; Korenczki, Ferenc; Katho, Agnes. Works, Gedeon Richter Ltd., Budapest, Hung. One-step synthesis of L-piperidine-2-carboxylic acid. Synthesis (1982), (2), 163. |
| Melting Point (Experimental) |
272 oC |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
158.0 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
0 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
-2.17 [Predicted by ALOGPS]; -2 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
|
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Download Spectrum Download FID (Bruker) Show Experimental Conditions  |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Download Spectrum Download FID (Bruker) Show Experimental Conditions  |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
|
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
|
| Biofluid Location |
|
| Tissue Location |
| Tissue |
References |
| Liver |
— |
|
| Concentrations (Normal) |
| Biofluid |
Blood |
| Value |
10.0 (0.0-20.0) uM |
| Age |
Children:1-13 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
|
| Concentrations (Abnormal) |
| Biofluid |
Blood |
| Value |
9.7 +/- 3.1 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Condition |
Peroxisomal biogenesis defect |
| Comments |
Not Available |
| References |
- Watkins PA, Chen WW, Harris CJ, Hoefler G, Hoefler S, Blake DC Jr, Balfe A, Kelley RI, Moser AB, Beard ME, et al.: Peroxisomal bifunctional enzyme deficiency. J Clin Invest. 1989 Mar;83(3):771-7. [PubMed
]
|
| Biofluid |
Blood |
| Value |
65.0 +/- 63.0 uM |
| Age |
Newborn:0-30 days old |
| Sex |
Both |
| Condition |
Adrenoleukodystrophy |
| Comments |
Not Available |
| References |
- Watkins PA, Chen WW, Harris CJ, Hoefler G, Hoefler S, Blake DC Jr, Balfe A, Kelley RI, Moser AB, Beard ME, et al.: Peroxisomal bifunctional enzyme deficiency. J Clin Invest. 1989 Mar;83(3):771-7. [PubMed
]
|
|
| Associated Disorders |
| Condition |
References |
| Adrenoleukodystrophy |
- Watkins PA, Chen WW, Harris CJ, Hoefler G, Hoefler S, Blake DC Jr, Balfe A, Kelley RI, Moser AB, Beard ME, et al.: Peroxisomal bifunctional enzyme deficiency. J Clin Invest. 1989 Mar;83(3):771-7. [PubMed
]
|
| Peroxisomal biogenesis defect |
- Watkins PA, Chen WW, Harris CJ, Hoefler G, Hoefler S, Blake DC Jr, Balfe A, Kelley RI, Moser AB, Beard ME, et al.: Peroxisomal bifunctional enzyme deficiency. J Clin Invest. 1989 Mar;83(3):771-7. [PubMed
]
|
|
| OMIM ID |
- 300100
(Adrenoleukodystrophy)
- 214100
(Peroxisomal biogenesis defect)
|
| Pathways |
|
| General References |
- Mihalik SJ, Moser HW, Watkins PA, Danks DM, Poulos A, Rhead WJ: Peroxisomal L-pipecolic acid oxidation is deficient in liver from Zellweger syndrome patients. Pediatr Res. 1989 May;25(5):548-52. [PubMed
]
- Baumgartner MR, Jansen GA, Verhoeven NM, Mooyer PA, Jakobs C, Roels F, Espeel M, Fourmaintraux A, Bellet H, Wanders RJ, Saudubray JM: Atypical refsum disease with pipecolic acidemia and abnormal catalase distribution. Ann Neurol. 2000 Jan;47(1):109-13. [PubMed
]
- Lam S: Stereoselective analysis of D and L dansyl amino acids as the mixed chelate copper(II) complexes by HPLC. J Chromatogr Sci. 1984 Sep;22(9):416-23. [PubMed
]
|
| Metabolic Enzymes |
- Peroxisomal sarcosine oxidase
- cDNA FLJ14592 fis, clone NT2RM4002063, highly similar to Peroxisomal sarcosine oxidase (EC 1.5.3.1)
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
5354 |
| Enzyme 1 Name |
Peroxisomal sarcosine oxidase |
| Enzyme 1 Synonyms |
- PSO
- L-pipecolate oxidase
- L-pipecolic acid oxidase
|
| Enzyme 1 Gene Name |
PIPOX |
| Enzyme 1 Protein Sequence |
>Peroxisomal sarcosine oxidase
MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCL
SSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINP
GLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVS
QAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS
FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLAPFRISRFPSLGKAHL
|
| Enzyme 1 Number of Residues |
390 |
| Enzyme 1 Molecular Weight |
44067 |
| Enzyme 1 Theoretical pI |
8.54 |
| Enzyme 1 GO Classification |
| Function |
- catalytic activity
- oxidoreductase activity
- oxidoreductase activity, acting on the CH-NH group of donors
- oxidoreductase activity, acting on the CH-NH group of donors, oxygen as acceptor
- sarcosine oxidase activity
|
| Process |
- aromatic compound metabolism
- cellular metabolism
- electron transport
- folic acid and derivative metabolism
- generation of precursor metabolites and energy
- metabolism
- physiological process
- tetrahydrofolate metabolism
|
| Component |
| — |
|
| Enzyme 1 General Function |
Amino acid transport and metabolism |
| Enzyme 1 Specific Function |
Metabolizes sarcosine, L-pipecolic acid and L-proline |
| Enzyme 1 Pathways |
|
| Enzyme 1 Reactions |
- L-pipecolate + O2 = 2,3,4,5-tetrahydropyridine-2-carboxylate + H2O2
|
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
|
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
7157903  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
Q9P0Z9  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
SOX_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
>1173 bp
ATGGCGGCTCAGAAAGATCTCTGGGACGCCATTGTGATTGGGGCGGGGATCCAGGGCTGC
TTCACTGCATACCACCTCGCCAAACACAGGAAGAGGATCCTCCTGCTGGAGCAGTTCTTT
CTACCACACTCCCGAGGAAGCTCCCATGGACAAAGCCGGATAATCCGAAAGGCGTACCTG
GAAGACTTTTACACCCGGATGATGCATGAGTGCTATCAGATATGGGCCCAGCTGGAGCAC
GAGGCTGGAACCCAATTGCACAGGCAGACTGGATTACTGCTGCTGGGAATGAAAGAGAAT
CAAGAATTAAAGACAATCCAGGCCAATCTGTCGAGGCAGAGGGTAGAACACCAGTGTCTT
TCATCTGAGGAACTGAAGCAACGTTTCCCAAATATTCGGTTGCCCAGGGGAGAAGTGGGG
CTCTTGGACAATTCCGGAGGAGTTATCTATGCATATAAGGCCCTCAGAGCCCTGCAGGAT
GCAATTCGACAGCTAGGAGGCATAGTGCGTGACGGAGAGAAGGTGGTGGAGATAAACCCA
GGGCTACTGGTCACGGTGAAAACCACCTCCAGGAGCTACCAAGCTAAGAGCTTGGTCATC
ACAGCAGGTCCTTGGACCAACCAGCTCCTCCGTCCCCTGGGCATTGAGATGCCTCTCCAG
ACCCTGCGGATCAACGTGTGTTACTGGCGAGAGATGGTTCCTGGGAGCTATGGTGTGTCC
CAGGCCTTTCCGTGCTTCCTGTGGCTGGGCTTGTGTCCCCACCACATCTACGGACTGCCC
ACAGGAGAGTACCCAGGGCTGATGAAGGTCAGCTATCACCACGGCAACCACGCAGACCCT
GAGGAGCGGGACTGCCCCACAGCACGCACAGACATCGGAGACGTCCAGATCCTGAGCAGC
TTTGTCAGAGATCACTTACCTGATCTGAAGCCCGAGCCTGCTGTCATTGAGAGCTGCATG
TACACGAATACCCCTGATGAGCAGTTCATTCTCGATCGCCACCCAAAGTATGACAACATT
GTCATTGGTGCTGGATTCTCTGGGCACGGGTTCAAGCTGGCCCCTGTGGTGGGGAAGATC
CTGTATGAATTAAGCATGAAATTAACACCATCTTATGACTTGGCACCTTTTCGAATCAGC
CGTTTCCCAAGCCTGGCCAAAGCCCACCTGTGA
|
| Enzyme 1 GenBank Gene ID |
AF134593  |
| Enzyme 1 GeneCard ID |
PIPOX  |
| Enzyme 1 GenAtlas ID |
PIPOX  |
| Enzyme 1 HGNC ID |
HGNC:17804  |
| Enzyme 1 Chromosome Location |
17 |
| Enzyme 1 Locus |
17q11.2 |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
- Dodt G, Kim DG, Reimann SA, Reuber BE, McCabe K, Gould SJ, Mihalik SJ: L-Pipecolic acid oxidase, a human enzyme essential for the degradation of L-pipecolic acid, is most similar to the monomeric sarcosine oxidases. Biochem J. 2000 Feb 1;345 Pt 3:487-94. [PubMed
]
- Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed
]
|
| Enzyme 1 Metabolite References |
Not Available |
|
Enzyme 2
[top]
|
| Enzyme 2 ID |
16475 |
| Enzyme 2 Name |
cDNA FLJ14592 fis, clone NT2RM4002063, highly similar to Peroxisomal sarcosine oxidase (EC 1.5.3.1) |
| Enzyme 2 Synonyms |
- SubName: Pipecolic acid oxidase, isoform CRA_b
|
| Enzyme 2 Gene Name |
PIPOX |
| Enzyme 2 Protein Sequence |
>cDNA FLJ14592 fis, clone NT2RM4002063, highly similar to Peroxisomal sarcosine oxidase (EC 1.5.3.1)
MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCL
SSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINP
GLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVS
QAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS
FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLAPFRISRFPSLGKAHL
|
| Enzyme 2 Number of Residues |
390 |
| Enzyme 2 Molecular Weight |
44067 |
| Enzyme 2 Theoretical pI |
8.54 |
| Enzyme 2 GO Classification |
| Function |
- catalytic activity
- oxidoreductase activity
- oxidoreductase activity, acting on the CH-NH group of donors
- oxidoreductase activity, acting on the CH-NH group of donors, oxygen as acceptor
- sarcosine oxidase activity
|
| Process |
- aromatic compound metabolism
- cellular metabolism
- electron transport
- folic acid and derivative metabolism
- generation of precursor metabolites and energy
- metabolism
- physiological process
- tetrahydrofolate metabolism
|
| Component |
| — |
|
| Enzyme 2 General Function |
Amino acid transport and metabolism |
| Enzyme 2 Specific Function |
Not Available |
| Enzyme 2 Pathways |
Not Available |
| Enzyme 2 Reactions |
- sarcosine + H2O + O2 = glycine + formaldehyde + H2O2 [RN:R00610] ALL_REAC R00610
|
| Enzyme 2 Pfam Domain Function |
|
| Enzyme 2 Signals |
|
| Enzyme 2 Transmembrane Regions |
|
| Enzyme 2 Essentiality |
Not Available |
| Enzyme 2 GenBank ID Protein |
Not Available |
| Enzyme 2 UniProtKB/Swiss-Prot ID |
B3KNH0  |
| Enzyme 2 UniProtKB/Swiss-Prot Entry Name |
B3KNH0_HUMAN  |
| Enzyme 2 PDB ID |
Not Available |
| Enzyme 2 Cellular Location |
Not Available |
| Enzyme 2 Gene Sequence |
Not Available |
| Enzyme 2 GenBank Gene ID |
AK027498  |
| Enzyme 2 GeneCard ID |
B3KNH0  |
| Enzyme 2 GenAtlas ID |
Not Available |
| Enzyme 2 HGNC ID |
Not Available |
| Enzyme 2 Chromosome Location |
17 |
| Enzyme 2 Locus |
17q11.2 |
| Enzyme 2 SNPs |
SNPJam Report  |
| Enzyme 2 General References |
Not Available |
| Enzyme 2 Metabolite References |
Not Available |