| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2010-04-26 12:38:39 |
| Accession Number |
HMDB01200 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
N'-Formylkynurenine |
| Description |
Plays an especially improtant role in photobiological responses. The excited states of N-formylkynurenine react to produce hydroxyl radicals. |
| Synonyms |
- 3-(N-formylanthraniloyl)-Alanine
- Formylkynurenine
- N'-Formylkynurenine
- N'-formyl-Kynurenine
- N-Formyl-L-kynurenine
- alpha-amino-2-(formylamino)-gamma-oxo-Benzenebutanoate
- alpha-amino-2-(formylamino)-gamma-oxo-Benzenebutanoic acid
- N-formyl-D-kynurenine
- N-formyl-delta-kynurenine
|
| Chemical IUPAC Name |
2-amino-4-(2-formamidophenyl)-4-oxo-butanoic acid |
| Chemical Formula |
C11H12N2O4 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Amino acids and Amino Acid conjugates
|
| Class |
- Amino Acids
- Amino Ketones
|
| Sub Class |
|
| Family |
|
| Species |
- ketone
- primary amine
- primary aliphatic amine (alkylamine)
- carboxylic acid
- secondary carboxylic acid amide
- aromatic compound
- alpha-aminoacid
|
| Biofunction |
- Component of Tryptophan metabolism
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
236.224 |
| Monoisotopic Molecular Weight |
236.079712 |
| Isomeric SMILES |
NC(CC(=O)C1=CC=CC=C1NC=O)C(O)=O |
| Canonical SMILES |
NC(CC(=O)C1=CC=CC=C1NC=O)C(O)=O |
| KEGG Compound ID |
C02406  |
| BioCyc ID |
N-FORMYLKYNURENINE  |
| BiGG ID |
1445551  |
| Wikipedia Link |
N'-Formylkynurenine  |
| NuGOwiki Link |
HMDB01200  |
| Metagene Link |
HMDB01200  |
| METLIN ID |
Not Available |
| PubChem Compound |
910  |
| PubChem Substance |
710919  |
| ChEBI ID |
18377  |
| CAS Registry Number |
1022-31-7 |
| InChI Identifier |
InChI=1/C11H12N2O4/c12-8(11(16)17)5-10(15)7-3-1-2-4-9(7)13-6-14/h1-4,6,8H,5,12H2,(H,13,14)(H,16,17) |
| Synthesis Reference |
Jayson, G. G.; Scholes, G.; Weiss, J. Formation of formylkynurenine by the action of x-rays on tryptophan in aqueous solution. Biochemical Journal (1954), 57 386-90. |
| Melting Point (Experimental) |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
1.05 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
0 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
-1.85 [Predicted by ALOGPS]; -2.3 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Not Available |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Not Available |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
Not Available |
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
- Cytoplasm (Predicted from LogP)
|
| Biofluid Location |
Not Available |
| Tissue Location |
Not Available |
| Concentrations (Normal) |
Not Available |
| Concentrations (Abnormal) |
Not Available |
| Associated Disorders |
Not Available |
| OMIM ID |
Not Available |
| Pathways |
|
| General References |
- Wong PW, Forman P, Tabahoff B, Justice P: A defect in tryptophan metabolism. Pediatr Res. 1976 Aug;10(8):725-30. [PubMed
]
- Wikipedia

|
| Metabolic Enzymes |
- Probable arylformamidase
- Indoleamine 2,3-dioxygenase-like protein 1
- cDNA FLJ75236, highly similar to Human tryptophan oxygenase
- Kynureninase
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
13059 |
| Enzyme 1 Name |
Probable arylformamidase |
| Enzyme 1 Synonyms |
- Kynurenine formamidase
- KF
|
| Enzyme 1 Gene Name |
AFMID |
| Enzyme 1 Protein Sequence |
>Probable arylformamidase
MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATR
KSLLHVPYGDGEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVA
VVIVAYGIAPKGTLDHMVDQVTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTK
HGVTPNLRGFFLVSGVFDLEPIVYTSQNVALQLTLEDAQRNNPQLKVAQAQPVDPTCRVL
VVVGQFDSPEFHRQSWEFYQVLPVQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQ
IILKTIFQ
|
| Enzyme 1 Number of Residues |
308 |
| Enzyme 1 Molecular Weight |
34556 |
| Enzyme 1 Theoretical pI |
5.78 |
| Enzyme 1 GO Classification |
Not Available |
| Enzyme 1 General Function |
Lipid transport and metabolism |
| Enzyme 1 Specific Function |
Catalyzes the hydrolysis of N-formyl-L-kynurenine to L- kynurenine, the second step in the conversion of tryptophan to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites |
| Enzyme 1 Pathways |
- Glyoxylate and Dicarboxylate Metabolism (map00630
)
- Tryptophan Metabolism (map00380
)
|
| Enzyme 1 Reactions |
- N-formyl-L-kynurenine + H2O = formate + L-kynurenine [RN:R01959] ALL_REAC R01959
- (other) R00988 R04911
|
| Enzyme 1 Pfam Domain Function |
Not Available |
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
|
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
52545961  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
Q63HM1  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
AFMID_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
Not Available |
| Enzyme 1 GenBank Gene ID |
BX648442  |
| Enzyme 1 GeneCard ID |
Q63HM1  |
| Enzyme 1 GenAtlas ID |
AFMID  |
| Enzyme 1 HGNC ID |
HGNC:20910  |
| Enzyme 1 Chromosome Location |
Not Available |
| Enzyme 1 Locus |
Not Available |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
Not Available |
| Enzyme 1 Metabolite References |
Not Available |
|
Enzyme 2
[top]
|
| Enzyme 2 ID |
13115 |
| Enzyme 2 Name |
Indoleamine 2,3-dioxygenase-like protein 1 |
| Enzyme 2 Synonyms |
- Indoleamine-pyrrole 2,3-dioxygenase-like protein 1
|
| Enzyme 2 Gene Name |
INDOL1 |
| Enzyme 2 Protein Sequence |
>Indoleamine 2,3-dioxygenase-like protein 1
MEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQ
AHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSR
NLGLPPILVHSDLVLTNWTKKDPDGNLETIISFPGGESLHGFILVTALVEKEAVPGIKAL
VQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNP
AMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHK
AFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYHITMVTKYLITAAAKAKHG
KPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG
|
| Enzyme 2 Number of Residues |
402 |
| Enzyme 2 Molecular Weight |
44865 |
| Enzyme 2 Theoretical pI |
6.94 |
| Enzyme 2 GO Classification |
| Function |
- binding
- heme binding
- tetrapyrrole binding
|
| Process |
| — |
| Component |
| — |
|
| Enzyme 2 General Function |
Not Available |
| Enzyme 2 Specific Function |
Not Available |
| Enzyme 2 Pathways |
Not Available |
| Enzyme 2 Reactions |
Not Available |
| Enzyme 2 Pfam Domain Function |
|
| Enzyme 2 Signals |
|
| Enzyme 2 Transmembrane Regions |
|
| Enzyme 2 Essentiality |
Not Available |
| Enzyme 2 GenBank ID Protein |
34536196  |
| Enzyme 2 UniProtKB/Swiss-Prot ID |
Q6ZQW0  |
| Enzyme 2 UniProtKB/Swiss-Prot Entry Name |
I23OL_HUMAN  |
| Enzyme 2 PDB ID |
Not Available |
| Enzyme 2 Cellular Location |
Not Available |
| Enzyme 2 Gene Sequence |
Not Available |
| Enzyme 2 GenBank Gene ID |
AK128691  |
| Enzyme 2 GeneCard ID |
Q6ZQW0  |
| Enzyme 2 GenAtlas ID |
INDOL1  |
| Enzyme 2 HGNC ID |
HGNC:27269  |
| Enzyme 2 Chromosome Location |
Not Available |
| Enzyme 2 Locus |
Not Available |
| Enzyme 2 SNPs |
SNPJam Report  |
| Enzyme 2 General References |
Not Available |
| Enzyme 2 Metabolite References |
Not Available |
|
Enzyme 3
[top]
|
| Enzyme 3 ID |
13117 |
| Enzyme 3 Name |
cDNA FLJ75236, highly similar to Human tryptophan oxygenase |
| Enzyme 3 Synonyms |
- TDOmRNA
- Tryptophan 2,3-dioxygenase, isoform CRA_b
|
| Enzyme 3 Gene Name |
TDO2 |
| Enzyme 3 Protein Sequence |
>cDNA FLJ75236, highly similar to Human tryptophan oxygenase
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
|
| Enzyme 3 Number of Residues |
406 |
| Enzyme 3 Molecular Weight |
47872 |
| Enzyme 3 Theoretical pI |
6.93 |
| Enzyme 3 GO Classification |
Not Available |
| Enzyme 3 General Function |
Amino acid transport and metabolism |
| Enzyme 3 Specific Function |
Not Available |
| Enzyme 3 Pathways |
Not Available |
| Enzyme 3 Reactions |
Not Available |
| Enzyme 3 Pfam Domain Function |
Not Available |
| Enzyme 3 Signals |
|
| Enzyme 3 Transmembrane Regions |
|
| Enzyme 3 Essentiality |
Not Available |
| Enzyme 3 GenBank ID Protein |
158259859  |
| Enzyme 3 UniProtKB/Swiss-Prot ID |
A8K053  |
| Enzyme 3 UniProtKB/Swiss-Prot Entry Name |
A8K053_HUMAN  |
| Enzyme 3 PDB ID |
Not Available |
| Enzyme 3 Cellular Location |
Not Available |
| Enzyme 3 Gene Sequence |
Not Available |
| Enzyme 3 GenBank Gene ID |
AK289418  |
| Enzyme 3 GeneCard ID |
A8K053  |
| Enzyme 3 GenAtlas ID |
Not Available |
| Enzyme 3 HGNC ID |
Not Available |
| Enzyme 3 Chromosome Location |
Not Available |
| Enzyme 3 Locus |
Not Available |
| Enzyme 3 SNPs |
SNPJam Report  |
| Enzyme 3 General References |
Not Available |
| Enzyme 3 Metabolite References |
Not Available |
|
Enzyme 4
[top]
|
| Enzyme 4 ID |
13118 |
| Enzyme 4 Name |
Kynureninase |
| Enzyme 4 Synonyms |
- L-kynurenine hydrolase
- Kynureninase
- L-kynurenine hydrolase, isoform CRA_a
|
| Enzyme 4 Gene Name |
KYNU |
| Enzyme 4 Protein Sequence |
>Kynureninase
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLS
LVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLM
KDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHG
LNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAG
QAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
ARSEFFN
|
| Enzyme 4 Number of Residues |
307 |
| Enzyme 4 Molecular Weight |
34635 |
| Enzyme 4 Theoretical pI |
5.71 |
| Enzyme 4 GO Classification |
| Function |
- binding
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on acid carbon-carbon bonds
- hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances
- kynureninase activity
- pyridoxal phosphate binding
- vitamin binding
|
| Process |
- NAD biosynthesis
- amino acid and derivative metabolism
- amino acid derivative metabolism
- biogenic amine metabolism
- cellular metabolism
- coenzyme biosynthesis
- coenzyme metabolism
- cofactor metabolism
- indolalkylamine metabolism
- metabolism
- physiological process
- pyridine nucleotide biosynthesis
- tryptophan catabolism
- tryptophan metabolism
|
| Component |
- cell
- cytoplasm
- intracellular
|
|
| Enzyme 4 General Function |
Amino acid transport and metabolism |
| Enzyme 4 Specific Function |
Not Available |
| Enzyme 4 Pathways |
Not Available |
| Enzyme 4 Reactions |
Not Available |
| Enzyme 4 Pfam Domain Function |
Not Available |
| Enzyme 4 Signals |
|
| Enzyme 4 Transmembrane Regions |
|
| Enzyme 4 Essentiality |
Not Available |
| Enzyme 4 GenBank ID Protein |
12654129  |
| Enzyme 4 UniProtKB/Swiss-Prot ID |
Q9BVW3  |
| Enzyme 4 UniProtKB/Swiss-Prot Entry Name |
Q9BVW3_HUMAN  |
| Enzyme 4 PDB ID |
Not Available |
| Enzyme 4 Cellular Location |
Not Available |
| Enzyme 4 Gene Sequence |
Not Available |
| Enzyme 4 GenBank Gene ID |
BC000879  |
| Enzyme 4 GeneCard ID |
Q9BVW3  |
| Enzyme 4 GenAtlas ID |
KYNU  |
| Enzyme 4 HGNC ID |
HGNC:6469  |
| Enzyme 4 Chromosome Location |
Not Available |
| Enzyme 4 Locus |
Not Available |
| Enzyme 4 SNPs |
SNPJam Report  |
| Enzyme 4 General References |
- Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed
]
|
| Enzyme 4 Metabolite References |
Not Available |