| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2009-06-23 13:49:03 |
| Accession Number |
HMDB01231 |
| Secondary Accession Numbers |
HMDB06264 |
| Common Name |
27-Deoxy-5b-cyprinol |
| Description |
27-Deoxy-5b-cyprinol is an intermediate in Bile acid synthesis pathway, in a sequence of reactions catalyzed by sterol 27-hydroxylase (CYP27) in the oxidation of 5 beta-cholestane-3 alpha,7 alpha,12 alpha,27-tetrol into 3 alpha,7 alpha,12 alpha-trihydroxy-5 beta-cholestanoic acid (PMID: 8496170).
5 beta-cholestane-3 alpha,7 alpha,12 alpha,25-tetrol 3-glucuronide, a metabolite of 27-Deoxy-5b-cyprinol, is the major bile alcohol component in serum from cerebrotendinous xanthomatosis patients (PMID: 7920441) |
| Synonyms |
- 5-beta-cholestane-3-alpha-7-alpha-12-alpha-26-tetraol
- 5b-Cholestane-3a,7a,12a,26-tetrol
- 5-b-Cholestane-3a-7-tetraol
- 3a,7a,12a,26-Tetrahydroxy-5b-cholestane
- 5-beta-Cholestane-3a-7-tetraol
- (25R)-5-beta-cholestane-3-alpha,7-alpha,12-alpha,26-tetraol;5beta-cholestane-3alpha,7alpha,12alpha,27-tetraol
- 5beta-cholestane-3alpha,7alpha,12alpha,27-tetrol
- 5beta-cholestane-3alpha,7alpha,12alpha,27alpha-tetrol
|
| Chemical IUPAC Name |
17-(7-hydroxy-6-methyl-heptan-2-yl)-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthrene-3,7,12-triol |
| Chemical Formula |
C27H48O4 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Cholesterols and derivatives
|
| Class |
- Steroids and Steroid Derivatives
|
| Sub Class |
|
| Family |
|
| Species |
- primary alcohol
- secondary alcohol
|
| Biofunction |
- Hormones, Membrane component
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
436.668 |
| Monoisotopic Molecular Weight |
436.355255 |
| Isomeric SMILES |
CC(CO)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3C[C@H](O)[C@]12C |
| Canonical SMILES |
CC(CO)CCCC(C)C1CCC2C3C(O)CC4CC(O)CCC4(C)C3CC(O)C12C |
| KEGG Compound ID |
Not Available |
| BioCyc ID |
5-BETA-CHOLESTANE-3-ALPHA7-TETRAOL  |
| BiGG ID |
45828  |
| Wikipedia Link |
Not Available |
| NuGOwiki Link |
HMDB01231  |
| Metagene Link |
HMDB01231  |
| METLIN ID |
6095  |
| PubChem Compound |
140  |
| PubChem Substance |
6821725  |
| ChEBI ID |
Not Available |
| CAS Registry Number |
862-53-3 |
| InChI Identifier |
InChI=1/C27H48O4/c1-16(15-28)6-5-7-17(2)20-8-9-21-25-22(14-24(31)27(20,21)4)26(3)11-10-19(29)12-18(26)13-23(25)30/h16-25,28-31H,5-15H2,1-4H3/t16?,17-,18+,19-,20-,21+,22+,23?,24+,25+,26+,27-/m1/s1 |
| Synthesis Reference |
Not Available |
| Melting Point (Experimental) |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
0.0211 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
0 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
3.77 [Predicted by ALOGPS]; 5.6 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Not Available |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Not Available |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
Not Available |
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
|
| Biofluid Location |
Not Available |
| Tissue Location |
Not Available |
| Concentrations (Normal) |
Not Available |
| Concentrations (Abnormal) |
Not Available |
| Associated Disorders |
Not Available |
| OMIM ID |
Not Available |
| Pathways |
|
| General References |
Not Available |
| Metabolic Enzymes |
- cDNA FLJ76781, highly similar to Homo sapiens cytochrome P450, family 27, subfamily A, polypeptide 1
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
13003 |
| Enzyme 1 Name |
cDNA FLJ76781, highly similar to Homo sapiens cytochrome P450, family 27, subfamily A, polypeptide 1 |
| Enzyme 1 Synonyms |
- CYP27A1, mRNA
- Cytochrome P450, family 27, subfamily A, polypeptide 1, isoform CRA_b
|
| Enzyme 1 Gene Name |
CYP27A1 |
| Enzyme 1 Protein Sequence |
>cDNA FLJ76781, highly similar to Homo sapiens cytochrome P450, family 27, subfamily A, polypeptide 1
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEI
PRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQ
EGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNE
VIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTF
VRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA
GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEA
LHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRR
IAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
|
| Enzyme 1 Number of Residues |
531 |
| Enzyme 1 Molecular Weight |
60236 |
| Enzyme 1 Theoretical pI |
9.16 |
| Enzyme 1 GO Classification |
Not Available |
| Enzyme 1 General Function |
Secondary metabolites biosynthesis, transport and catabolism |
| Enzyme 1 Specific Function |
Not Available |
| Enzyme 1 Pathways |
Not Available |
| Enzyme 1 Reactions |
Not Available |
| Enzyme 1 Pfam Domain Function |
Not Available |
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
|
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
158261859  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
A8K303  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
A8K303_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
Not Available |
| Enzyme 1 GenBank Gene ID |
AK290418  |
| Enzyme 1 GeneCard ID |
A8K303  |
| Enzyme 1 GenAtlas ID |
Not Available |
| Enzyme 1 HGNC ID |
Not Available |
| Enzyme 1 Chromosome Location |
Not Available |
| Enzyme 1 Locus |
Not Available |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
Not Available |
| Enzyme 1 Metabolite References |
Not Available |