| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2009-05-05 20:58:48 |
| Accession Number |
HMDB01496 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
7a-Hydroxycholesterol |
| Description |
7alpha-hydroxycholesterol is an oxysterol and can serve as a biomarker for lipid peroxidation. (PMID: 17386651) Products of cholesterol oxidation accumulate within atherosclerotic plaque and have been proposed to contribute to inflammatory signalling in the diseased artery. (PMID: 17364953)
7alpha-hydroxycholesterol is a cholesterol oxide that has been described as biomarker of oxidative stress in subjects with impaired glucose tolerance and diabetes. (PMID: 16634125) |
| Synonyms |
- 7alpha-Hydroxycholesterol
- 7 alpha-Hydroxycholesterol
- Cholest-5-ene-3beta,7alpha-diol
- 7-alpha-hydroxycholesterol
- 7-a-Hydroxycholesterol
|
| Chemical IUPAC Name |
10,13-dimethyl-17-(6-methylheptan-2-yl)-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthrene-3,7-diol |
| Chemical Formula |
C27H46O2 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Cholesterols and derivatives
|
| Class |
- Steroids and Steroid Derivatives
|
| Sub Class |
|
| Family |
|
| Species |
|
| Biofunction |
- Hormones, Membrane component
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
402.653 |
| Monoisotopic Molecular Weight |
402.349792 |
| Isomeric SMILES |
CC(C)CCC[C@@H](C)[C@H]1CC[C@@H]2C3[C@H](O)C=C4C[C@@H](O)CC[C@]4(C)[C@H]3CC[C@]12C |
| Canonical SMILES |
CC(C)CCCC(C)C1CCC2C3C(O)C=C4CC(O)CCC4(C)C3CCC12C |
| KEGG Compound ID |
C03594  |
| BioCyc ID |
CPD-266  |
| BiGG ID |
42155  |
| Wikipedia Link |
Not Available |
| NuGOwiki Link |
HMDB01496  |
| Metagene Link |
HMDB01496  |
| METLIN ID |
6280  |
| PubChem Compound |
405  |
| PubChem Substance |
2363  |
| ChEBI ID |
17500  |
| CAS Registry Number |
Not Available |
| InChI Identifier |
InChI=1/C27H46O2/c1-17(2)7-6-8-18(3)21-9-10-22-25-23(12-14-27(21,22)5)26(4)13-11-20(28)15-19(26)16-24(25)29/h16-18,20-25,28-29H,6-15H2,1-5H3/t18-,20+,21-,22-,23+,24-,25-,26+,27-/m1/s1 |
| Synthesis Reference |
Not Available |
| Melting Point (Experimental) |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
4.76e-04 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
0 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
5.61 [Predicted by ALOGPS]; 6.8 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Not Available |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Not Available |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
Not Available |
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
- Membrane (Predicted from LogP)
- endoplasmic reticulum
|
| Biofluid Location |
- Blood
- Cerebrospinal Fluid
|
| Tissue Location |
Not Available |
| Concentrations (Normal) |
| Biofluid |
Blood |
| Value |
0.18 +/- 0.047 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Hahn C, Reichel C, von Bergmann K: Serum concentration of 7 alpha-hydroxycholesterol as an indicator of bile acid synthesis in humans. J Lipid Res. 1995 Sep;36(9):2059-66. [PubMed
]
|
| Biofluid |
CSF |
| Value |
0.004 +/- 0.0016 uM |
| Age |
Adult:>18 yrs old |
| Sex |
N/A |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Leoni V, Lutjohann D, Masterman T: Levels of 7-oxocholesterol in cerebrospinal fluid are more than one thousand times lower than reported in multiple sclerosis. J Lipid Res. 2005 Feb;46(2):191-5. Epub 2004 Dec 1. [PubMed
]
|
|
| Concentrations (Abnormal) |
| Biofluid |
Blood |
| Value |
0.054 +/- 0.019 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Condition |
Cirrhosis |
| Comments |
Advanced liver disease and biopsy-proven cirrhosis |
| References |
- Hahn C, Reichel C, von Bergmann K: Serum concentration of 7 alpha-hydroxycholesterol as an indicator of bile acid synthesis in humans. J Lipid Res. 1995 Sep;36(9):2059-66. [PubMed
]
|
| Biofluid |
CSF |
| Value |
0.005 +/- 0.0021 uM |
| Age |
Adult:>18 yrs old |
| Sex |
N/A |
| Condition |
Multiple sclerosis |
| Comments |
Not Available |
| References |
- Leoni V, Lutjohann D, Masterman T: Levels of 7-oxocholesterol in cerebrospinal fluid are more than one thousand times lower than reported in multiple sclerosis. J Lipid Res. 2005 Feb;46(2):191-5. Epub 2004 Dec 1. [PubMed
]
|
|
| Associated Disorders |
| Condition |
References |
| Cirrhosis |
- Hahn C, Reichel C, von Bergmann K: Serum concentration of 7 alpha-hydroxycholesterol as an indicator of bile acid synthesis in humans. J Lipid Res. 1995 Sep;36(9):2059-66. [PubMed
]
|
| Multiple sclerosis |
- Leoni V, Lutjohann D, Masterman T: Levels of 7-oxocholesterol in cerebrospinal fluid are more than one thousand times lower than reported in multiple sclerosis. J Lipid Res. 2005 Feb;46(2):191-5. Epub 2004 Dec 1. [PubMed
]
|
|
| OMIM ID |
|
| Pathways |
|
| General References |
Not Available |
| Metabolic Enzymes |
- Cytochrome P450 7A1
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
5749 |
| Enzyme 1 Name |
Cytochrome P450 7A1 |
| Enzyme 1 Synonyms |
- Cholesterol 7-alpha-monooxygenase
- CYPVII
- Cholesterol 7-alpha-hydroxylase
|
| Enzyme 1 Gene Name |
CYP7A1 |
| Enzyme 1 Protein Sequence |
>Cytochrome P450 7A1
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGN
TTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMF
EAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE
SLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLD
QSRAGLGILPPLNDIEFKYKFKHL
|
| Enzyme 1 Number of Residues |
504 |
| Enzyme 1 Molecular Weight |
57661 |
| Enzyme 1 Theoretical pI |
8.34 |
| Enzyme 1 GO Classification |
| Function |
- binding
- catalytic activity
- cation binding
- heme binding
- ion binding
- iron ion binding
- monooxygenase activity
- oxidoreductase activity
- tetrapyrrole binding
- transition metal ion binding
|
| Process |
- cellular metabolism
- electron transport
- generation of precursor metabolites and energy
- metabolism
- physiological process
|
| Component |
| — |
|
| Enzyme 1 General Function |
Secondary metabolites biosynthesis, transport and catabolism |
| Enzyme 1 Specific Function |
Cholesterol + NADPH + O(2) = 7-alpha- hydroxycholesterol + NADP(+) + H(2)O |
| Enzyme 1 Pathways |
|
| Enzyme 1 Reactions |
- cholesterol + NADPH + H+ + O2 = 7alpha-hydroxycholesterol + NADP+ + H2O
|
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
Not Available |
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
23909  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
P22680  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
CP7A1_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
>1515 bp
ATGATGACCACATCTTTGATTTGGGGGATTGCTATAGCAGCATGCTGTTGTCTATGGCTT
ATTCTTGGAATTAGGAGAAGGCAAACGGGTGAACCACCTCTAGAGAATGGATTAATTCCA
TACCTGGGCTGTGCTCTGCAATTTGGTGCCAATCCTCTTGAGTTCCTCAGAGCAAATCAA
AGGAAACATGGTCATGTTTTTACCTGCAAACTAATGGGAAAATATGTCCATTTCATCACA
AATCCCTTGTCATACCATAAGGTGTTGTGCCACGGAAAATATTTTGATTGGAAAAAATTT
CACTTTGCTACTTCTGCGAAGGCATTTGGGCACAGAAGCATTGACCCGATGGATGGAAAT
ACCACTGAAAACATAAACGACACTTTCATCAAAACCCTGCAGGGCCATGCCTTGAATTCC
CTCACGGAAAGCATGATGGAAAACCTCCAACGTATCATGAGACCTCCAGTCTCCTCTAAC
TCAAAGACCGCTGCCTGGGTGACAGAAGGGATGTATTCTTTCTGCTACCGAGTGATGTTT
GAAGCTGGGTATTTAACTATCTTTGGCAGAGATCTTACAAGGCGGGACACACAGAAAGCA
CATATTCTAAACAATCTTGACAACTTCAAGCAATTCGACAAAGTCTTTCCAGCCCTGGTA
GCAGGCCTCCCCATTCACATGTTCAGGACTGCGCACAATGCCCGGGAGAAACTGGCAGAG
AGCTTGAGGCACGAGAACCTCCAAAAGAGGGAAAGCATCTCAGAACTGATCAGCCTGCGC
ATGTTTCTCAATGACACTTTGTCCACCTTTGATGATCTGGAGAAGGCCAAGACACACCTC
GTGGTCCTCTGGGCATCGCAAGCAAACACCATTCCAGCGACTTTCTGGAGTTTATTTCAA
ATGATTAGGAACCCAGAAGCAATGAAAGCAGCTACTGAAGAAGTGAAAAGAACATTAGAG
AATGCTGGTCAAAAAGTCAGCTTGGAAGGCAATCCTATTTGTTTGAGTCAAGCAGAACTG
AATGACCTGCCAGTATTAAATAGTATAATCAAGGAATCGCTGAGGCTTTCCAGTGCCTCC
CTCAACATCCGGACAGCTAAGGAGGATTTCACTTTGCACCTTGAGGACGGTTCCTACAAC
ATCCGAAAAGATAGCATCATAGCTCTTTACCCACAGTTAATGCACTTAGATCCAGAAATC
TACCCAGACCCTTTGACTTTTAAATATGATAGGTATCTTGATGAAAACGGGAAGACAAAG
ACTACCTTCTATTGTAATGGACTCAAGTTAAAGTATTACTACATGCCCTTTGGATCGGGA
GCTACAATATGTCCTGGAAGATTGTTCGCTATCCACGAAATCAAGCAATTTTTGATTCTG
ATGCTTTCTTATTTTGAATTGGAGCTTATAGAGGGCCAAGCTAAATGTCCACCTTTGGAC
CAGTCCCGGGCAGGCTTGGGCATTTTGCCGCCATTGAATGATATTGAATTTAAATATAAA
TTCAAGCATTTGTGA
|
| Enzyme 1 GenBank Gene ID |
X56088  |
| Enzyme 1 GeneCard ID |
CYP7A1  |
| Enzyme 1 GenAtlas ID |
CYP7A1  |
| Enzyme 1 HGNC ID |
HGNC:2651  |
| Enzyme 1 Chromosome Location |
Not Available |
| Enzyme 1 Locus |
Not Available |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
- Nishimoto M, Noshiro M, Okuda K: Structure of the gene encoding human liver cholesterol 7 alpha-hydroxylase. Biochim Biophys Acta. 1993 Feb 20;1172(1-2):147-50. [PubMed
]
- Noshiro M, Okuda K: Molecular cloning and sequence analysis of cDNA encoding human cholesterol 7 alpha-hydroxylase. FEBS Lett. 1990 Jul 30;268(1):137-40. [PubMed
]
- Karam WG, Chiang JY: Polymorphisms of human cholesterol 7 alpha-hydroxylase. Biochem Biophys Res Commun. 1992 Jun 15;185(2):588-95. [PubMed
]
- Wang DP, Chiang JY: Structure and nucleotide sequences of the human cholesterol 7 alpha-hydroxylase gene (CYP7). Genomics. 1994 Mar 15;20(2):320-3. [PubMed
]
- Molowa DT, Chen WS, Cimis GM, Tan CP: Transcriptional regulation of the human cholesterol 7 alpha-hydroxylase gene. Biochemistry. 1992 Mar 10;31(9):2539-44. [PubMed
]
- Saito S, Iida A, Sekine A, Kawauchi S, Higuchi S, Ogawa C, Nakamura Y: Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population. J Hum Genet. 2003;48(5):249-70. Epub 2003 Apr 29. [PubMed
]
|
| Enzyme 1 Metabolite References |
Not Available |