We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for Docosahexaenoic acid (HMDB02183)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2006-05-22 15:17:40
Update Date 2009-11-22 23:38:52
Accession Number HMDB02183
Secondary Accession Numbers Not Available
Common Name Docosahexaenoic acid
Description Docosahexaenoic acid (DHA) is an omega-3 essential fatty acid. Chemically, DHA is a carboxylic acid with a 22-carbon chain and six cis double bonds with the first double bond is located at the third carbon from the omega end. DHA is most often found in fish oil. It is a major fatty acid in sperm and brain phospholipids, especially in the retina. Dietary DHA can reduce the level of blood triglycerides in humans, which may reduce the risk of heart disease. (wikipedia)
Synonyms
  1. 4,7,10,13,16,19-Docosahexaenoate
  2. 4,7,10,13,16,19-Docosahexaenoic acid
  3. Cervonate
  4. Cervonic acid
  5. Doconexent
  6. Doconexento
  7. Doconexentum
  8. Docosahexaenoate
  9. Docosahexaenoic acid
  10. Doxonexent
  11. all-Z-Docosahexaenoate
  12. all-Z-Docosahexaenoic acid
  13. cis-4,7,10,13,16,19-Docosahexanoate
  14. cis-4,7,10,13,16,19-Docosahexanoic acid
Chemical IUPAC Name (4Z,7Z,10Z,13Z,16Z,19Z)-4,7,10,13,16,19-Docosahexaenoic acid
Chemical Formula C22H32O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Fatty Acids
Sub Class
  • Long chain fatty acids
Family
  • Mammalian Metabolite
Species
  • carboxylic acid
  • alkene
Biofunction
—
Application
—
Source
  • Endogenous
Average Molecular Weight 328.488
Monoisotopic Molecular Weight 328.240234
Isomeric SMILES CCC=C/CC=C/CC=C/CC=C/CC=C/CC=C/CCC(O)=O
Canonical SMILES CCC=CCC=CCC=CCC=CCC=CCC=CCCC(O)=O
KEGG Compound ID Not Available
BioCyc ID D-HEXOSE-6-PHOSPHATE Link Image
BiGG ID 1586190 Link Image
Wikipedia Link Docosahexaenoic acid Link Image
NuGOwiki Link HMDB02183 Link Image
Metagene Link HMDB02183 Link Image
METLIN ID 3457 Link Image
PubChem Compound 6433873 Link Image
PubChem Substance 174742 Link Image
ChEBI ID Not Available
CAS Registry Number 6217-54-5
InChI Identifier InChI=1/C22H32O2/c1-2-3-4-5-6-7-8-9-10-11-12-13-14-15-16-17-18-19-20-21-22(23)24/h3-4,6-7,9-10,12-13,15-16,18-19H,2,5,8,11,14,17,20-21H2,1H3,(H,23,24)/b4-3-,7-6-,10-9-,13-12-,16-15-,19-18-
Synthesis Reference Wright, Stephen W.; Kuo, Elaine Y.; Corey, E. J. An effective process for the isolation of Docosahexaenoic acid in quantity from cod liver oil. Journal of Organic Chemistry (1987), 52(19), 4399-4401.
Melting Point (Experimental) Not Available
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 1.86e-04 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 6.83 [Predicted by ALOGPS]; 6.723 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • Extracellular
Biofluid Location
  • Blood
  • Cerebrospinal Fluid
  • Urine
Tissue Location
Tissue References
Adipose Tissue —
Brain —
Epidermis —
Erythrocyte —
Fibroblasts —
Intestine —
Kidney —
Liver —
Myelin —
Nervous Tissues —
Neuron —
Pancreas —
Placenta —
Platelet —
Prostate —
Retina —
Skeletal Muscle —
Testes —
Concentrations (Normal)
Biofluid Blood
Value 1.777 +/- 0.796 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Nikolaos Psychogios, David D. Hau, Jun Peng, An Chi Guo, Rupasri Mandal, Souhaila Bouatra, Igor Sinelnikov, Ramanarayan Krishnamurthy, Roman Eisner, Bijaya Gautam, Nelson Young, Jinaguo Xia, Craig Knox, Ying Wei Dong, Paul Huang, Janet McManus, Theresa Pedersen, Fiona Bamforth, Russ Greiner, Bruce McManus, John Newman, David S. Wishart, The Human Serum Metabolome, PLoS ONE (Submitted).
  • Wishart DS, Knox C, Guo AC, Eisner R, Young N, Gautam B, Hau DD, Psychogios N, Dong E, Bouatra S, Mandal R, Sinelnikov I, Xia J, Jia L, Cruz JA, Lim E, Sobsey CA, Shrivastava S, Huang P, Liu P, Fang L, Peng J, Fradette R, Cheng D, Tzur D, Clements M, Lewis A, De Souza A, Zuniga A, Dawe M, Xiong Y, Clive D, Greiner R, Nazyrova A, Shaykhutdinov R, Li L, Vogel HJ, Forsythe I: HMDB: a knowledgebase for the human metabolome. Nucleic Acids Res. 2008 Oct 25. [PubMed Link Image]
Biofluid Blood
Value 2.3 +/- 1.2 uM
Age Adult:>18 yrs old
Sex Both
Patient information Fasted subjects
Comments Not Available
References
  • Kargas G, Rudy T, Spennetta T, Takayama K, Querishi N, Shrago E: Separation and quantitation of long-chain free fatty acids in human serum by high-performance liquid chromatography. J Chromatogr. 1990 Apr 6;526(2):331-40. [PubMed Link Image]
Biofluid Blood
Value 0.9 +/- 0.3 uM
Age Adult:>18 yrs old
Sex Both
Patient information Fed subjects
Comments Not Available
References
  • Kargas G, Rudy T, Spennetta T, Takayama K, Querishi N, Shrago E: Separation and quantitation of long-chain free fatty acids in human serum by high-performance liquid chromatography. J Chromatogr. 1990 Apr 6;526(2):331-40. [PubMed Link Image]
Biofluid Blood
Value 94.2 +/- 31.3 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Biofluid Blood
Value 90.9 +/- 21.6 uM
Age Adult:>18 yrs old
Sex Male
Patient information Normal
Comments Not Available
References
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Biofluid Blood
Value 98.7 +/- 41.0 uM
Age Adult:>18 yrs old
Sex Female
Patient information Normal
Comments Not Available
References
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Biofluid CSF
Value 0.15 +/- 0.015 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Pilitsis JG, Coplin WM, O'Regan MH, Wellwood JM, Diaz FG, Fairfax MR, Michael DB, Phillis JW: Measurement of free fatty acids in cerebrospinal fluid from patients with hemorrhagic and ischemic stroke. Brain Res. 2003 Sep 26;985(2):198-201. [PubMed Link Image]
Biofluid Urine
Value 5.5 +/- 6.3 umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Kim KM, Jung BH, Lho DS, Chung WY, Paeng KJ, Chung BC: Alteration of urinary profiles of endogenous steroids and polyunsaturated fatty acids in thyroid cancer. Cancer Lett. 2003 Dec 30;202(2):173-9. [PubMed Link Image]
Concentrations (Abnormal)
Biofluid Blood
Value 64.7 +/- 39.2 uM
Age Adult:>18 yrs old
Sex Both
Condition Hypertension
Comments n=109 Essential hypertension
References
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Biofluid Blood
Value 56.6 +/- 36.7 uM
Age Adult:>18 yrs old
Sex Male
Condition Essential hypertension
Comments Not Available
References
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Biofluid Blood
Value 83.0 +/- 39.0 uM
Age Adult:>18 yrs old
Sex Female
Condition Essential hypertension
Comments Not Available
References
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Biofluid CSF
Value 1.43 +/- 0.3 uM
Age Adult:>18 yrs old
Sex Both
Condition Stroke
Comments Ischemic and/or hemorrhagic
References
  • Pilitsis JG, Coplin WM, O'Regan MH, Wellwood JM, Diaz FG, Fairfax MR, Michael DB, Phillis JW: Measurement of free fatty acids in cerebrospinal fluid from patients with hemorrhagic and ischemic stroke. Brain Res. 2003 Sep 26;985(2):198-201. [PubMed Link Image]
Biofluid Urine
Value 4.4 +/- 9.4 umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Condition Thyroid cancer
Comments Not Available
References
  • Kim KM, Jung BH, Lho DS, Chung WY, Paeng KJ, Chung BC: Alteration of urinary profiles of endogenous steroids and polyunsaturated fatty acids in thyroid cancer. Cancer Lett. 2003 Dec 30;202(2):173-9. [PubMed Link Image]
Associated Disorders
Condition References
Essential hypertension
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Hypertension
  • Wang S, Ma A, Song S, Quan Q, Zhao X, Zheng X: Fasting serum free fatty acid composition, waist/hip ratio and insulin activity in essential hypertensive patients. Hypertens Res. 2008 Apr;31(4):623-32. [PubMed Link Image]
Stroke
  • Pilitsis JG, Coplin WM, O'Regan MH, Wellwood JM, Diaz FG, Fairfax MR, Michael DB, Phillis JW: Measurement of free fatty acids in cerebrospinal fluid from patients with hemorrhagic and ischemic stroke. Brain Res. 2003 Sep 26;985(2):198-201. [PubMed Link Image]
Thyroid cancer
  • Kim KM, Jung BH, Lho DS, Chung WY, Paeng KJ, Chung BC: Alteration of urinary profiles of endogenous steroids and polyunsaturated fatty acids in thyroid cancer. Cancer Lett. 2003 Dec 30;202(2):173-9. [PubMed Link Image]
OMIM ID
Pathways
Name SMPDB Link KEGG Link
Alpha Linolenic Acid and Linoleic Acid Metabolism SMP00018 Link Image map00592 Link Image
General References
  1. Watanabe A, Saito S, Tsuchida T, Higuchi K, Okita M: Low plasma levels of docosahexaenoic acid in patients with liver cirrhosis and its correction with a polyunsaturated fatty acid-enriched soft oil capsule. Nutrition. 1999 Apr;15(4):284-8. [PubMed Link Image]
  2. Sanders TA: Polyunsaturated fatty acids in the food chain in Europe. Am J Clin Nutr. 2000 Jan;71(1 Suppl):176S-8S. [PubMed Link Image]
  3. Gomez de Segura IA, Valderrabano S, Vazquez I, Vallejo-Cremades MT, Gomez-Garcia L, Sanchez M, de Miguel E: Protective effects of dietary enrichment with docosahexaenoic acid plus protein in 5-fluorouracil-induced intestinal injury in the rat. Eur J Gastroenterol Hepatol. 2004 May;16(5):479-85. [PubMed Link Image]
  4. Woodman RJ, Mori TA, Burke V, Puddey IB, Barden A, Watts GF, Beilin LJ: Effects of purified eicosapentaenoic acid and docosahexaenoic acid on platelet, fibrinolytic and vascular function in hypertensive type 2 diabetic patients. Atherosclerosis. 2003 Jan;166(1):85-93. [PubMed Link Image]
  5. Shingu T, Karanian JW, Kim HY, Yergey JA, Salem N Jr: Discovery of novel brain lipoxygenase products formed from docosahexaenoic acid (22:6w3). Adv Alcohol Subst Abuse. 1988;7(3-4):235-40. [PubMed Link Image]
  6. Hong S, Tjonahen E, Morgan EL, Lu Y, Serhan CN, Rowley AF: Rainbow trout (Oncorhynchus mykiss) brain cells biosynthesize novel docosahexaenoic acid-derived resolvins and protectins-Mediator lipidomic analysis. Prostaglandins Other Lipid Mediat. 2005 Dec;78(1-4):107-16. Epub 2005 Jun 13. [PubMed Link Image]
  7. Hibbeln JR, Bissette G, Umhau JC, George DT: Omega-3 status and cerebrospinal fluid corticotrophin releasing hormone in perpetrators of domestic violence. Biol Psychiatry. 2004 Dec 1;56(11):895-7. [PubMed Link Image]
  8. Jorgensen MH, Hernell O, Hughes E, Michaelsen KF: Is there a relation between docosahexaenoic acid concentration in mothers' milk and visual development in term infants? J Pediatr Gastroenterol Nutr. 2001 Mar;32(3):293-6. [PubMed Link Image]
  9. Crabtree JT, Gordon MJ, Campbell FM, Dutta-Roy AK: Differential distribution and metabolism of arachidonic acid and docosahexaenoic acid by human placental choriocarcinoma (BeWo) cells. Mol Cell Biochem. 1998 Aug;185(1-2):191-8. [PubMed Link Image]
  10. Gordon N: Nutrition and cognitive function. Brain Dev. 1997 Apr;19(3):165-70. [PubMed Link Image]
  11. Martinez M: Severe deficiency of docosahexaenoic acid in peroxisomal disorders: a defect of delta 4 desaturation? Neurology. 1990 Aug;40(8):1292-8. [PubMed Link Image]
  12. Bohles H, Arndt S, Ohlenschlager U, Beeg T, Gebhardt B, Sewell AC: Maternal plasma homocysteine, placenta status and docosahexaenoic acid concentration in erythrocyte phospholipids of the newborn. Eur J Pediatr. 1999 Mar;158(3):243-6. [PubMed Link Image]
  13. Crawford MA, Bloom M, Broadhurst CL, Schmidt WF, Cunnane SC, Galli C, Gehbremeskel K, Linseisen F, Lloyd-Smith J, Parkington J: Evidence for the unique function of docosahexaenoic acid during the evolution of the modern hominid brain. Lipids. 1999;34 Suppl:S39-47. [PubMed Link Image]
  14. Andersson L, Sternby B, Nilsson A: Hydrolysis of phosphatidylethanolamine by human pancreatic phospholipase A2. Effect of bile salts. Scand J Gastroenterol. 1994 Feb;29(2):182-7. [PubMed Link Image]
  15. Brossard N, Croset M, Normand S, Pousin J, Lecerf J, Laville M, Tayot JL, Lagarde M: Human plasma albumin transports [13C]docosahexaenoic acid in two lipid forms to blood cells. J Lipid Res. 1997 Aug;38(8):1571-82. [PubMed Link Image]
  16. Berry CB, Hayes D, Murphy A, Wiessner M, Rauen T, McBean GJ: Differential modulation of the glutamate transporters GLT1, GLAST and EAAC1 by docosahexaenoic acid. Brain Res. 2005 Mar 10;1037(1-2):123-33. [PubMed Link Image]
  17. Wikipedia Link Image
Metabolic Enzymes
  1. Cytochrome P450 2U1
Enzyme 1 [top]
Enzyme 1 ID 14354
Enzyme 1 Name Cytochrome P450 2U1
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name CYP2U1
Enzyme 1 Protein Sequence >Cytochrome P450 2U1 
MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGIP
PGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSF
FIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKF
SHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQR
FDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLPFGPFKELRQIEKDITSFLKK
IIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNS
LLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLA
IPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETF
IPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNIT
ISRR
Enzyme 1 Number of Residues 544
Enzyme 1 Molecular Weight 61988
Enzyme 1 Theoretical pI 8.53
Enzyme 1 GO Classification
Function
  • binding
  • catalytic activity
  • cation binding
  • heme binding
  • ion binding
  • iron ion binding
  • monooxygenase activity
  • oxidoreductase activity
  • oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
  • tetrapyrrole binding
  • transition metal ion binding
Process
  • cellular metabolism
  • electron transport
  • generation of precursor metabolites and energy
  • metabolism
  • physiological process
Component
—
Enzyme 1 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 1 Specific Function Catalyzes the hydroxylation of arachidonic acid, docosahexaenoic acid and other long chain fatty acids. May modulate the arachidonic acid signaling pathway and play a role in other fatty acid signaling processes
Enzyme 1 Pathways
Enzyme 1 Reactions
  • RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O [RN:R04122] ALL_REAC R04122 > R03629 R04121
  • (other) R01840 R02501 R05259 R07000 R07001 R07016 R07020 R07021 R07022 R07042 R07043 R07044 R07045 R07046 R07048 R07050 R07051 R07052 R07054 R07055 R07056 R07066 R07068 R07075 R07079 R07080 R07081 R07085 R07087 R07088 R07089 R07090 R07098 R07099 R07107 R07112 R07939 R07943 R07945
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 30-50 113-133 261-281 342-362 495-515
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 33521674 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q7Z449 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name CP2U1_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1635 bp 
ATGTCGTCTCCGGGGCCGTCGCAGCCGCCGGCCGAGGACCCGCCCTGGCCCGCGCGCCTC
CTGCGTGCGCCTCTGGGGCTGCTGCGGCTGGACCCCAGCGGGGGCGCGCTGCTGCTATGC
GGCCTCGTAGCGCTGCTGGGCTGGAGCTGGCTGCGGAGGCGCCGGGCGCGGGGCATCCCG
CCCGGGCCCACGCCCTGGCCTCTGGTGGGCAACTTCGGTCACGTGCTGCTGCCTCCCTTC
CTCCGGCGGCGGAGCTGGCTGAGCAGCAGGACCAGGGCCGCAGGGATTGATCCCTCGGTC
ATAGGCCCGCAGGTGCTCCTGGCTCACCTAGCCCGCGTGTACGGCAGCATCTTCAGCTTC
TTTATCGGCCACTACCTGGTGGTGGTCCTCAGCGACTTCCACAGCGTGCGCGAGGCGCTG
GTGCAGCAGGCCGAGGTCTTCAGCGACCGCCCGCGGGTGCCGCTCATCTCCATCGTGACC
AAGGAGAAGGGGGTTGTGTTTGCACATTATGGTCCCGTCTGGAGACAACAAAGGAAGTTC
TCTCATTCAACTCTTCGTCATTTTGGGTTGGGAAAACTTAGCTTGGAGCCCAAGATTATT
GAGGAGTTCAAATATGTGAAAGCAGAAATGCAAAAGCACGGAGAAGACCCCTTCTGTCCT
TTCTCCATCATCAGCAATGCCGTCTCTAACATCATTTGCTCCTTGTGCTTTGGCCAGCGC
TTTGATTACACTAATAGTGAGTTCAAGAAAATGCTTGGTTTTATGTCACGAGGCCTAGAA
ATCTGTCTGAACAGTCAAGTCCTCCTGGTCAACATATGCCCTTGGCTTTATTACCTTCCC
TTTGGACCATTTAAGGAATTAAGACAAATTGAAAAGGATATAACCAGTTTCCTTAAAAAA
ATCATCAAAGACCATCAAGAGTCTCTGGATAGAGAGAACCCTCAGGACTTCATAGACATG
TACCTTCTCCACATGGAAGAGGAGAGGAAAAATAATAGTAACAGCAGTTTTGATGAAGAG
TACTTATTTTATATCATTGGGGATCTCTTTATTGCTGGGACTGATACCACAACTAACTCT
TTGCTCTGGTGCCTGCTGTATATGTCGCTGAACCCCGATGTACAAGAAAAGGTTCATGAA
GAAATTGAAAGAGTCATTGGCGCCAACCGAGCTCCTTCCCTCACAGACAAGGCCCAGATG
CCCTACACAGAAGCCACCATCATGGAAGTGCAGAGGCTAACTGTGGTGGTGCCGCTTGCC
ATTCCTCATATGACCTCAGAGAACACAGTGCTCCAAGGGTATACCATTCCTAAAGGCACA
TTGATCTTACCCAACCTGTGGTCAGTACATAGAGACCCAGCCATTTGGGAGAAACCGGAG
GATTTCTACCCTAATCGATTTCTGGATGACCAAGGACAACTAATTAAAAAAGAAACCTTT
ATTCCTTTTGGGATAGGGAAGCGGGTGTGTATGGGAGAACAACTGGCAAAGATGGAATTA
TTCCTAATGTTTGTGAGCCTAATGCAGAGTTTCGCATTTGCTTTACCTGAGGATTCTAAG
AAGCCCCTCCTGACTGGAAGATTTGGTCTAACTTTAGCCCCACATCCATTTAATATAACT
ATTTCAAGGAGATGA
Enzyme 1 GenBank Gene ID AY343323 Link Image
Enzyme 1 GeneCard ID Q7Z449 Link Image
Enzyme 1 GenAtlas ID CYP2U1 Link Image
Enzyme 1 HGNC ID HGNC:20582 Link Image
Enzyme 1 Chromosome Location Not Available
Enzyme 1 Locus Not Available
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available