| Version |
2.5 |
| Creation Date |
2006-05-22 16:12:35 |
| Update Date |
2009-05-05 20:59:31 |
| Accession Number |
HMDB03134 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
Biocytin |
| Description |
Biocytin is a naturally occurring low molecular weight analog of biotin, and a primary source of this essential metabolite for mammals. Biotinidase acts as a hydrolase by cleaving biocytin and biotinyl-peptides, thereby liberating biotin for reutilization. Mammals cannot synthesize biotin and, therefore, derive the vitamin from dietary sources or from the endogenous turnover of the carboxylases. Free biotin can readily enter the biotin pool, whereas holocarboxylases or other biotin-containing proteins must first be degraded proteolytically to biocytin (biotinyl-e-lysine) or biotinyl-peptides. Biocytin is also an especially versatile marker for neuroanatomical investigations, shown that may have multiple applications, especially for labeling neurons. (PMID: 8930409, 1384763, 2479450) |
| Synonyms |
- Biotinyl-L-lysine
- H-Lys(biotinyl)-OH
- N-epsilon-Biotin-L-lysine
- N6-D-Biotinyl-L-lysine
- Ne-Biotynyl-L-lysine
- epsilon-N-Biotinyl-L-lysine
- N6-delta-Biotinyl-L-lysine
|
| Chemical IUPAC Name |
(2S)-2-amino-6-[5-[(1S,2S,5R)-7-oxo-3-thia-6,8-diazabicyclo[3.3.0]oct-2-yl]pentanoylamino]hexanoic acid |
| Chemical Formula |
C16H28N4O4S |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
|
| Class |
|
| Sub Class |
|
| Family |
|
| Species |
- thioether
- primary amine
- primary aliphatic amine (alkylamine)
- carboxylic acid
- secondary carboxylic acid amide
- urea
- heterocyclic compound
- alpha-aminoacid
|
| Biofunction |
| — |
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
372.483 |
| Monoisotopic Molecular Weight |
372.183136 |
| Isomeric SMILES |
N[C@@H](CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)C(O)=O |
| Canonical SMILES |
NC(CCCCNC(=O)CCCCC1SCC2NC(=O)NC12)C(O)=O |
| KEGG Compound ID |
C05552  |
| BioCyc ID |
Not Available |
| BiGG ID |
46012  |
| Wikipedia Link |
Not Available |
| NuGOwiki Link |
HMDB03134  |
| Metagene Link |
HMDB03134  |
| METLIN ID |
Not Available |
| PubChem Compound |
83814  |
| PubChem Substance |
10220364  |
| ChEBI ID |
Not Available |
| CAS Registry Number |
576-19-2 |
| InChI Identifier |
InChI=1/C16H28N4O4S/c17-10(15(22)23)5-3-4-8-18-13(21)7-2-1-6-12-14-11(9-25-12)19-16(24)20-14/h10-12,14H,1-9,17H2,(H,18,21)(H,22,23)(H2,19,20,24)/t10-,11-,12-,14-/m0/s1 |
| Synthesis Reference |
Not Available |
| Melting Point (Experimental) |
243 - 246 oC |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
0.17300001 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
0 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
-0.69 [Predicted by ALOGPS]; -2.1 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
|
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Download Spectrum Download FID (Varian) Show Experimental Conditions  |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Download Spectrum Download FID (Bruker) Show Experimental Conditions  |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
|
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
- Cytoplasm (Predicted from LogP)
- Extracellular
- mitochondria
- nucleus
|
| Biofluid Location |
Not Available |
| Tissue Location |
Not Available |
| Concentrations (Normal) |
Not Available |
| Concentrations (Abnormal) |
Not Available |
| Associated Disorders |
Not Available |
| OMIM ID |
Not Available |
| Pathways |
|
| General References |
- Spiga S, Fattore L, Puddu MC, Cappai A, Picciau S, Brotzu G, Serra GP, Petruzzo P: Use of biocytin as neuroanatomic tracer in harvested human pancreas: a confocal laser scanning microscopy analysis. Pancreas. 2002 May;24(4):329-35. [PubMed
]
- Altemus KL, Lavenex P, Ishizuka N, Amaral DG: Morphological characteristics and electrophysiological properties of CA1 pyramidal neurons in macaque monkeys. Neuroscience. 2005;136(3):741-56. [PubMed
]
- Evangelatos SA, Livaniou E, Kakabakos SE, Evangelatos GP, Ithakissios DS: Biotinidase radioassay using an 125I-biotin derivative, avidin, and polyethylene glycol reagents. Anal Biochem. 1991 Aug 1;196(2):385-9. [PubMed
]
- Ebrahim H, Dakshinamurti K: Determination of biocytin. Anal Biochem. 1987 May 1;162(2):319-24. [PubMed
]
- Suormala TM, Baumgartner ER, Bausch J, Holick W, Wick H: Quantitative determination of biocytin in urine of patients with biotinidase deficiency using high-performance liquid chromatography (HPLC). Clin Chim Acta. 1988 Oct 31;177(3):253-69. [PubMed
]
- Hymes J, Fleischhauer K, Wolf B: Biotinylation of biotinidase following incubation with biocytin. Clin Chim Acta. 1995 Jan 16;233(1-2):39-45. [PubMed
]
- Baur B, Suormala T, Bernoulli C, Baumgartner ER: Biotin determination by three different methods: specificity and application to urine and plasma ultrafiltrates of patients with and without disorders in biotin metabolism. Int J Vitam Nutr Res. 1998;68(5):300-8. [PubMed
]
- van Gog FB, Visser GW, Gowrising RW, Snow GB, van Dongen GA: Synthesis and evaluation of 99mTc/99Tc-MAG3-biotin conjugates for antibody pretargeting strategies. Nucl Med Biol. 1998 Oct;25(7):611-9. [PubMed
]
|
| Metabolic Enzymes |
- Biotinidase precursor
- Signal peptidase complex subunit 1
- cDNA, FLJ93758, Homo sapiens biotinidase (BTD), mRNA (Biotinidase, isoform CRA_a)
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
5817 |
| Enzyme 1 Name |
Biotinidase precursor |
| Enzyme 1 Synonyms |
Not Available |
| Enzyme 1 Gene Name |
BTD |
| Enzyme 1 Protein Sequence |
>Biotinidase precursor
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQ
EALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRW
NPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRD
YKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESF
WYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYAL
GVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFL
TSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD
|
| Enzyme 1 Number of Residues |
523 |
| Enzyme 1 Molecular Weight |
58914 |
| Enzyme 1 Theoretical pI |
5.72 |
| Enzyme 1 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
- hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
- hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
|
| Process |
- metabolism
- nitrogen compound metabolism
- physiological process
|
| Component |
| — |
|
| Enzyme 1 General Function |
Not Available |
| Enzyme 1 Specific Function |
Catalytic release of biotin from biocytin, the product of biotin-dependent carboxylases degradation |
| Enzyme 1 Pathways |
|
| Enzyme 1 Reactions |
- biotin amide + H2O = biotin + NH3
|
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
Not Available |
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
468824  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
P43251  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
BTD_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
>1632 bp
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATT
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTG
GGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCA
GCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGT
ATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCA
TTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCA
GCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAAT
CCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTAT
GACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTG
GTCAGGTGTGGGGGTCTTGGCTTCGACACCTGCGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTC
CTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAG
|
| Enzyme 1 GenBank Gene ID |
U03274  |
| Enzyme 1 GeneCard ID |
BTD  |
| Enzyme 1 GenAtlas ID |
BTD  |
| Enzyme 1 HGNC ID |
HGNC:1122  |
| Enzyme 1 Chromosome Location |
3 |
| Enzyme 1 Locus |
3p25 |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
- Cole H, Reynolds TR, Lockyer JM, Buck GA, Denson T, Spence JE, Hymes J, Wolf B: Human serum biotinidase. cDNA cloning, sequence, and characterization. J Biol Chem. 1994 Mar 4;269(9):6566-70. [PubMed
]
- Knight HC, Reynolds TR, Meyers GA, Pomponio RJ, Buck GA, Wolf B: Structure of the human biotinidase gene. Mamm Genome. 1998 Apr;9(4):327-30. [PubMed
]
- Pomponio RJ, Norrgard KJ, Hymes J, Reynolds TR, Buck GA, Baumgartner R, Suormala T, Wolf B: Arg538 to Cys mutation in a CpG dinucleotide of the human biotinidase gene is the second most common cause of profound biotinidase deficiency in symptomatic children. Hum Genet. 1997 Apr;99(4):506-12. [PubMed
]
- Swango KL, Demirkol M, Huner G, Pronicka E, Sykut-Cegielska J, Schulze A, Mayatepek E, Wolf B: Partial biotinidase deficiency is usually due to the D444H mutation in the biotinidase gene. Hum Genet. 1998 May;102(5):571-5. [PubMed
]
|
| Enzyme 1 Metabolite References |
Not Available |
|
Enzyme 2
[top]
|
| Enzyme 2 ID |
10515 |
| Enzyme 2 Name |
Signal peptidase complex subunit 1 |
| Enzyme 2 Synonyms |
- Microsomal signal peptidase 12 kDa subunit
- SPase 12 kDa subunit
|
| Enzyme 2 Gene Name |
SPCS1 |
| Enzyme 2 Protein Sequence |
>Signal peptidase complex subunit 1
MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC
LLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
|
| Enzyme 2 Number of Residues |
102 |
| Enzyme 2 Molecular Weight |
11805 |
| Enzyme 2 Theoretical pI |
Not Available |
| Enzyme 2 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- peptidase activity
- signal peptidase activity
|
| Process |
- cellular metabolism
- metabolism
- peptide metabolism
- physiological process
- signal peptide processing
|
| Component |
- cell
- cell fraction
- integral to membrane
- intrinsic to membrane
- membrane
- membrane fraction
- microsome
- protein complex
- signal peptidase complex
- vesicular fraction
|
|
| Enzyme 2 General Function |
Not Available |
| Enzyme 2 Specific Function |
Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum |
| Enzyme 2 Pathways |
Not Available |
| Enzyme 2 Reactions |
- Protein N6,N6,N6-trimethyl-L-lysine + H2O --> peptide sans lysine + N6,N6,N6-Trimethyl-L-lysine
|
| Enzyme 2 Pfam Domain Function |
|
| Enzyme 2 Signals |
|
| Enzyme 2 Transmembrane Regions |
|
| Enzyme 2 Essentiality |
Not Available |
| Enzyme 2 GenBank ID Protein |
16905460  |
| Enzyme 2 UniProtKB/Swiss-Prot ID |
Q9Y6A9  |
| Enzyme 2 UniProtKB/Swiss-Prot Entry Name |
SPCS1_HUMAN  |
| Enzyme 2 PDB ID |
Not Available |
| Enzyme 2 Cellular Location |
Not Available |
| Enzyme 2 Gene Sequence |
>309 bp
ATGCTGGAGCATCTGAGCTCGCTGCCCACGCAGATGGATTACAAGGGCCAGAAGCTAGCT
GAACAGATGTTTCAGGGAATTTATCTTTTTTCTGCAATAGTTGGATTTATCTACGGGTAC
GTGGCTGAACAGTTCGGGTGGACTGTCTATATAGTTATGGCCGGATTTGCTTTTTCATGT
TTGCTGACACTTCCTCCATGGCCCATCTATCGCCGGCATCCTCTCAAGTGGTTACCTGTT
CAAGAATCAAGCACAGACGACAAGAAACCAGGGGAAAGAAAAATTAAGAGGCATGCTAAA
AATAATTGA
|
| Enzyme 2 GenBank Gene ID |
L38852  |
| Enzyme 2 GeneCard ID |
SPCS1  |
| Enzyme 2 GenAtlas ID |
SPCS1  |
| Enzyme 2 HGNC ID |
HGNC:23401  |
| Enzyme 2 Chromosome Location |
3 |
| Enzyme 2 Locus |
3p21.1 |
| Enzyme 2 SNPs |
SNPJam Report  |
| Enzyme 2 General References |
- Kalies KU, Hartmann E: Membrane topology of the 12- and the 25-kDa subunits of the mammalian signal peptidase complex. J Biol Chem. 1996 Feb 16;271(7):3925-9. [PubMed
]
- Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed
]
|
| Enzyme 2 Metabolite References |
Not Available |
|
Enzyme 3
[top]
|
| Enzyme 3 ID |
16426 |
| Enzyme 3 Name |
cDNA, FLJ93758, Homo sapiens biotinidase (BTD), mRNA (Biotinidase, isoform CRA_a) |
| Enzyme 3 Synonyms |
Not Available |
| Enzyme 3 Gene Name |
BTD |
| Enzyme 3 Protein Sequence |
>cDNA, FLJ93758, Homo sapiens biotinidase (BTD), mRNA (Biotinidase, isoform CRA_a)
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVA
AVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNF
TRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRF
GIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAAN
VHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSN
GLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATG
IFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLY
ERD
|
| Enzyme 3 Number of Residues |
543 |
| Enzyme 3 Molecular Weight |
61134 |
| Enzyme 3 Theoretical pI |
6.22 |
| Enzyme 3 GO Classification |
| Function |
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
- hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
- hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
|
| Process |
- metabolism
- nitrogen compound metabolism
- physiological process
|
| Component |
| — |
|
| Enzyme 3 General Function |
Not Available |
| Enzyme 3 Specific Function |
Not Available |
| Enzyme 3 Pathways |
Not Available |
| Enzyme 3 Reactions |
Not Available |
| Enzyme 3 Pfam Domain Function |
|
| Enzyme 3 Signals |
|
| Enzyme 3 Transmembrane Regions |
|
| Enzyme 3 Essentiality |
Not Available |
| Enzyme 3 GenBank ID Protein |
Not Available |
| Enzyme 3 UniProtKB/Swiss-Prot ID |
B2R865  |
| Enzyme 3 UniProtKB/Swiss-Prot Entry Name |
B2R865_HUMAN  |
| Enzyme 3 PDB ID |
Not Available |
| Enzyme 3 Cellular Location |
Not Available |
| Enzyme 3 Gene Sequence |
Not Available |
| Enzyme 3 GenBank Gene ID |
AK313252  |
| Enzyme 3 GeneCard ID |
B2R865  |
| Enzyme 3 GenAtlas ID |
Not Available |
| Enzyme 3 HGNC ID |
Not Available |
| Enzyme 3 Chromosome Location |
Not Available |
| Enzyme 3 Locus |
Not Available |
| Enzyme 3 SNPs |
SNPJam Report  |
| Enzyme 3 General References |
Not Available |
| Enzyme 3 Metabolite References |
Not Available |