We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for D-Proline (HMDB03411)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2006-08-12 21:18:30
Update Date 2009-05-05 20:59:36
Accession Number HMDB03411
Secondary Accession Numbers Not Available
Common Name D-Proline
Description D-proline is an isomer of the naturally occurring amino acid, L-Proline. D-amino acids have been found in relatively high abundance in human plasma and saliva (PMID: 16480744). These amino acids may be of bacterial origin, but there is also evidence that they are endogenously produced through amino acid racemase activity. (PMID: 1426150)
Synonyms
  1. R-Proline
  2. (R)-pyrrolidine-2-carboxylic acid
  3. (R)-pyrrolidine-2-carboxylate
  4. (2R)-pyrrolidine-2-carboxylate
  5. D-Prolin
  6. (2R)-pyrrolidine-2-carboxylic acid
  7. D-proline
  8. R)-2-Carboxypyrrolidine
Chemical IUPAC Name (2R)-pyrrolidine-2-carboxylic acid
Chemical Formula C5H9NO2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian Metabolite
Species
  • secondary amine
  • secondary aliphatic amine (dialkylamine)
  • carboxylic acid
  • heterocyclic compound
  • alpha-aminoacid
Biofunction
  • Component of Arginine and proline metabolism
Application
—
Source
  • Endogenous
Average Molecular Weight 115.131
Monoisotopic Molecular Weight 115.063332
Isomeric SMILES OC(=O)[C@H]1CCCN1
Canonical SMILES OC(=O)C1CCCN1
KEGG Compound ID C00763 Link Image
BioCyc ID CPD-656 Link Image
BiGG ID 35916 Link Image
Wikipedia Link Not Available
NuGOwiki Link HMDB03411 Link Image
Metagene Link HMDB03411 Link Image
METLIN ID Not Available
PubChem Compound 8988 Link Image
PubChem Substance 4025 Link Image
ChEBI ID 16313 Link Image
CAS Registry Number 344-25-2
InChI Identifier InChI=1/C5H9NO2/c7-5(8)4-2-1-3-6-4/h4,6H,1-3H2,(H,7,8)/t4-/m1/s1
Synthesis Reference Not Available
Melting Point (Experimental) 221 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 365.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -2.71 [Predicted by ALOGPS]; -2.4 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
  • lysosome
  • peroxisome
Biofluid Location Not Available
Tissue Location Not Available
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Associated Disorders Not Available
OMIM ID Not Available
Pathways
Name SMPDB Link KEGG Link
Arginine and Proline Metabolism SMP00020 Link Image map00330 Link Image
General References
  1. Goan SR, Junghahn I, Wissler M, Becker M, Aumann J, Just U, Martiny-Baron G, Fichtner I, Henschler R: Donor stromal cells from human blood engraft in NOD/SCID mice. Blood. 2000 Dec 1;96(12):3971-8. [PubMed Link Image]
  2. Rhaleb NE, Peng H, Harding P, Tayeh M, LaPointe MC, Carretero OA: Effect of N-acetyl-seryl-aspartyl-lysyl-proline on DNA and collagen synthesis in rat cardiac fibroblasts. Hypertension. 2001 Mar;37(3):827-32. [PubMed Link Image]
  3. Clayton PT, Eaton S, Aynsley-Green A, Edginton M, Hussain K, Krywawych S, Datta V, Malingre HE, Berger R, van den Berg IE: Hyperinsulinism in short-chain L-3-hydroxyacyl-CoA dehydrogenase deficiency reveals the importance of beta-oxidation in insulin secretion. J Clin Invest. 2001 Aug;108(3):457-65. [PubMed Link Image]
  4. Humbertclaude V, Rivier F, Roubertie A, Echenne B, Bellet H, Vallat C, Morin D: Is hyperprolinemia type I actually a benign trait? Report of a case with severe neurologic involvement and vigabatrin intolerance. J Child Neurol. 2001 Aug;16(8):622-3. [PubMed Link Image]
  5. Watkins NA, Smethurst PA, Allen D, Smith GA, Ouwehand WH: Platelet alphaIIbbeta3 recombinant autoantibodies from the B-cell repertoire of a post-transfusion purpura patient. Br J Haematol. 2002 Mar;116(3):677-85. [PubMed Link Image]
  6. Lalko CC, Deppe E, Ulatowski D, Lutgen A, Hart AP, Patton EA, Lunn DP, Suresh M, Darien BJ: Equine platelet CD62P (P-selectin) expression: a phenotypic and morphologic study. Vet Immunol Immunopathol. 2003 Jan 30;91(2):119-34. [PubMed Link Image]
  7. Ozyurt H, Totan A, Sahin S, Kilinc C, Sogut S, Akyol O: Maternal serum and amniotic fluid hydroxyproline levels in neural tube defects. Fetal Diagn Ther. 2003 Sep-Oct;18(5):321-3. [PubMed Link Image]
  8. Schwan WR, Wetzel KJ, Gomez TS, Stiles MA, Beitlich BD, Grunwald S: Low-proline environments impair growth, proline transport and in vivo survival of Staphylococcus aureus strain-specific putP mutants. Microbiology. 2004 Apr;150(Pt 4):1055-61. [PubMed Link Image]
  9. Bonafe M, Salvioli S, Barbi C, Trapassi C, Tocco F, Storci G, Invidia L, Vannini I, Rossi M, Marzi E, Mishto M, Capri M, Olivieri F, Antonicelli R, Memo M, Uberti D, Nacmias B, Sorbi S, Monti D, Franceschi C: The different apoptotic potential of the p53 codon 72 alleles increases with age and modulates in vivo ischaemia-induced cell death. Cell Death Differ. 2004 Sep;11(9):962-73. [PubMed Link Image]
  10. Sarkar A, Caamano S, Fernandez JM: The elasticity of individual titin PEVK exons measured by single molecule atomic force microscopy. J Biol Chem. 2005 Feb 25;280(8):6261-4. Epub 2005 Jan 4. [PubMed Link Image]
  11. Babraj JA, Cuthbertson DJ, Smith K, Langberg H, Miller B, Krogsgaard MR, Kjaer M, Rennie MJ: Collagen synthesis in human musculoskeletal tissues and skin. Am J Physiol Endocrinol Metab. 2005 Nov;289(5):E864-9. Epub 2005 Jun 21. [PubMed Link Image]
  12. Vitari AC, Deak M, Morrice NA, Alessi DR: The WNK1 and WNK4 protein kinases that are mutated in Gordon's hypertension syndrome phosphorylate and activate SPAK and OSR1 protein kinases. Biochem J. 2005 Oct 1;391(Pt 1):17-24. [PubMed Link Image]
  13. Metzner L, Kottra G, Neubert K, Daniel H, Brandsch M: Serotonin, L-tryptophan, and tryptamine are effective inhibitors of the amino acid transport system PAT1. FASEB J. 2005 Sep;19(11):1468-73. [PubMed Link Image]
  14. Nagata Y, Higashi M, Ishii Y, Sano H, Tanigawa M, Nagata K, Noguchi K, Urade M: The presence of high concentrations of free D-amino acids in human saliva. Life Sci. 2006 Mar 6;78(15):1677-81. Epub 2006 Feb 9. [PubMed Link Image]
  15. Broer S: The SLC6 orphans are forming a family of amino acid transporters. Neurochem Int. 2006 May-Jun;48(6-7):559-67. Epub 2006 Mar 15. [PubMed Link Image]
  16. Meyer W, Poehling HM, Neurand K: Intraepidermal distribution of free amino acids in porcine skin. J Dermatol Sci. 1991 Sep;2(5):383-92. [PubMed Link Image]
  17. Corfield AP, Clamp JR, Casey AD, Paraskeva C: Characterization of a sialic-acid-rich mucus glycoprotein secreted by a premalignant human colorectal adenoma cell line. Int J Cancer. 1990 Dec 15;46(6):1059-65. [PubMed Link Image]
  18. Wolf GC, Hilton CW, Prasad C, Miller JM Jr, Thorneycroft IH: The neuropeptide histidyl proline diketopiperazine throughout human pregnancy: an inverse correlation with amniotic fluid prolactin. Am J Obstet Gynecol. 1990 Mar;162(3):740-5. [PubMed Link Image]
  19. Prasad C: Cyclo(His-Pro): its distribution, origin and function in the human. Neurosci Biobehav Rev. 1988 Spring;12(1):19-22. [PubMed Link Image]
  20. Chambers ST, Kunin CM: Osmoprotective activity for Escherichia coli in mammalian renal inner medulla and urine. Correlation of glycine and proline betaines and sorbitol with response to osmotic loads. J Clin Invest. 1987 Nov;80(5):1255-60. [PubMed Link Image]
  21. Roesel RA, Blankenship PR, Mobley EB, Coryell ME: Increased excretion of histidyl-L-proline diketopiperazine by infants receiving Pregestimil and Nutramigen formulas. Clin Chem. 1986 May;32(5):865-7. [PubMed Link Image]
  22. Linkosalo E, Markkanen H, Syrjanen S: Effects of a lacto-ovo-vegetarian diet on the free amino acid composition of wax-stimulated whole human saliva. J Nutr. 1985 May;115(5):588-92. [PubMed Link Image]
  23. Kubilus J, MacDonald MJ, Baden HP: Epidermal proteins of cultured human and bovine keratinocytes. Biochim Biophys Acta. 1979 Jun 19;578(2):484-92. [PubMed Link Image]
  24. Manicourt D, Brauman H, Orloff S: Synovial fluid beta 2 microglobulin and hydroxyproline fractions in rheumatoid arthritis and nonautoimmune arthropathies. Ann Rheum Dis. 1980 Jun;39(3):207-16. [PubMed Link Image]
  25. Miller DR, Mankin HJ, Shoji H, D'Ambrosia RD: Identification of fibronectin in preparations of osteoarthritic human cartilage. Connect Tissue Res. 1984;12(3-4):267-75. [PubMed Link Image]
  26. Bogovski PA, Rooma MA, Kann JM: Studies on the excretion of endogenously formed N-nitrosoproline. I. Percutaneous excretion of N-nitrosoproline in humans. IARC Sci Publ. 1984;(57):199-204. [PubMed Link Image]
  27. Maurer G, Schreier E, Delaborde S, Nufer R, Shukla AP: Fate and disposition of bromocriptine in animals and man. II: Absorption, elimination and metabolism. Eur J Drug Metab Pharmacokinet. 1983;8(1):51-62. [PubMed Link Image]
  28. Levison PR, Tomalin G: The kinetics of hydrolysis of some extended N-aminoacyl-L-arginine methyl esters by human plasma kallikrein. Evidence for subsites S2 and S3. Biochem J. 1982 Apr 1;203(1):149-53. [PubMed Link Image]
  29. Canalis E, Raisz LG: Effect of fibroblast growth factor on cultured fetal rat calvaria. Metabolism. 1980 Feb;29(2):108-14. [PubMed Link Image]
  30. Whiteley J, Francis MJ, Walton RJ, Smith R: Serum proline imino-peptidase activity in normal adult subjects and in patients with Paget's disease of bone. Clin Chim Acta. 1976 Sep 6;71(2):157-63. [PubMed Link Image]
  31. Nakamura M, Zhang ZQ, Shan L, Hisa T, Sasaki M, Tsukino R, Yokoi T, Kaname A, Kakudo K: Allelic variants of human calcitonin receptor in the Japanese population. Hum Genet. 1997 Jan;99(1):38-41. [PubMed Link Image]
Metabolic Enzymes
  1. D-amino-acid oxidase
  2. cDNA, FLJ93456, highly similar to Homo sapiens D-amino-acid oxidase (DAO), mRNA (D-amino-acid oxidase, isoform CRA_c)
  3. Probable proline racemase
Enzyme 1 [top]
Enzyme 1 ID 5438
Enzyme 1 Name D-amino-acid oxidase
Enzyme 1 Synonyms
  1. DAMOX
  2. DAO
  3. DAAO
Enzyme 1 Gene Name DAO
Enzyme 1 Protein Sequence >D-amino-acid oxidase 
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Enzyme 1 Number of Residues 347
Enzyme 1 Molecular Weight 39475
Enzyme 1 Theoretical pI 6.84
Enzyme 1 GO Classification
Function
  • D-amino-acid oxidase activity
  • catalytic activity
  • oxidoreductase activity
  • oxidoreductase activity, acting on the CH-NH2 group of donors
  • oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
Process
  • cellular metabolism
  • electron transport
  • generation of precursor metabolites and energy
  • metabolism
  • physiological process
Component
—
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids
Enzyme 1 Pathways
  • Arginine and Proline Metabolism (map00330 Link Image)
  • D-Arginine and D-ornithine Metabolism (map00472 Link Image)
  • Glycine, Serine and Threonine Metabolism (map00260 Link Image)
Enzyme 1 Reactions
  • a D-amino acid + H2O + O2 = a 2-oxo acid + ammonia + H2O2
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-16
Enzyme 1 Transmembrane Regions Not Available
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 30446 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P14920 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name OXDA_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1044 bp 
ATGCGTGTGGTGGTGATTGGAGCAGGAGTCATCGGGCTGTCCACCGCCCTCTGCATCCAT
GAGCGCTACCACTCAGTCCTGCAGCCACTGCACATAAAGGTCTACGCGGACCGCTTCACC
CCACTCACCACCACCGACGTGGCTGCCGGCCTCTGGCAGCCCTACCTTTCTGACCCCAAC
AACCCACAGGAGGCGGACTGGAGCCAACAGACCTTTGACTATCTCCTGAGCCATGTCCAT
TCTCCCAACGCTGAAAACCTGGGCCTGTTCCTAATCTCGGGCTACAACCTCTTCCATGAA
GCCATTCCGGACCCTTCCTGGAAGGACACAGTTCTGGGATTTCGGAAGCTGACCCCCAGA
GAGCTGGATATGTTCCCAGATTACGGCTATGGCTGGTTCCACACAAGCCTAATTCTGGAG
GGAAAGAACTATCTACAGTGGCTGACTGAAAGGTTAACTGAGAGGGGAGTGAAGTTCTTC
CAGCGGAAAGTGGAGTCTTTTGAGGAGGTGGCAAGAGAAGGCGCAGACGTGATTGTCAAC
TGCACTGGGGTATGGGCTGGGGCGCTACAACGAGACCCCCTGCTGCAGCCAGGCCGGGGG
CAGATCATGAAGGTGGACGCCCCTTGGATGAAGCACTTCATTCTCACCCATGACCCAGAG
AGAGGCATCTACAATTCCCCGTACATCATCCCAGGGACCCAGACAGTTACTCTTGGAGGC
ATCTTCCAGTTGGGAAACTGGAGTGAACTAAACAATATCCAGGACCACAACACCATTTGG
GAAGGCTGCTGCAGACTGGAGCCCACACTGAAGAATGCAAGAATTATTGGTGAAGCAACT
GGCTTCCGGCCAGTACGCCCCCAGATTCGGCTAGAAAGAGAACAGCTTCGCACTGGACCT
TCAAACACAGAGGTCATCCACAACTATGGCCATGGAGGCTACGGGCTCACCATCCACTGG
GGATGTGCCCTGGAGGCAGCCAAGCTCTTTGGGAGAATCCTGGAAGAAAAGAAATTGTCC
AGAATGCCACCATCCCACCTCTGA
Enzyme 1 GenBank Gene ID X13227 Link Image
Enzyme 1 GeneCard ID DAO Link Image
Enzyme 1 GenAtlas ID DAO Link Image
Enzyme 1 HGNC ID HGNC:2671 Link Image
Enzyme 1 Chromosome Location 12
Enzyme 1 Locus 12q24
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. Momoi K, Fukui K, Watanabe F, Miyake Y: Molecular cloning and sequence analysis of cDNA encoding human kidney D-amino acid oxidase. FEBS Lett. 1988 Sep 26;238(1):180-4. [PubMed Link Image]
  2. Fukui K, Miyake Y: Molecular cloning and chromosomal localization of a human gene encoding D-amino-acid oxidase. J Biol Chem. 1992 Sep 15;267(26):18631-8. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 16461
Enzyme 2 Name cDNA, FLJ93456, highly similar to Homo sapiens D-amino-acid oxidase (DAO), mRNA (D-amino-acid oxidase, isoform CRA_c)
Enzyme 2 Synonyms Not Available
Enzyme 2 Gene Name DAO
Enzyme 2 Protein Sequence >cDNA, FLJ93456, highly similar to Homo sapiens D-amino-acid oxidase (DAO), mRNA (D-amino-acid oxidase, isoform CRA_c) 
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Enzyme 2 Number of Residues 347
Enzyme 2 Molecular Weight 39475
Enzyme 2 Theoretical pI 6.84
Enzyme 2 GO Classification
Function
  • ATP binding
  • D-amino-acid oxidase activity
  • RNA ligase activity
  • adenyl nucleotide binding
  • binding
  • catalytic activity
  • ligase activity
  • ligase activity, forming phosphoric ester bonds
  • nucleotide binding
  • oxidoreductase activity
  • oxidoreductase activity, acting on the CH-NH2 group of donors
  • oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
  • purine nucleotide binding
  • tRNA ligase activity
Process
  • RNA metabolism
  • cellular metabolism
  • electron transport
  • generation of precursor metabolites and energy
  • metabolism
  • nucleobase, nucleoside, nucleotide and nucleic acid metabolism
  • physiological process
  • tRNA aminoacylation
  • tRNA aminoacylation for protein translation
  • tRNA metabolism
Component
—
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function Not Available
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein Not Available
Enzyme 2 UniProtKB/Swiss-Prot ID B2R7I5 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name B2R7I5_HUMAN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence Not Available
Enzyme 2 GenBank Gene ID AK312995 Link Image
Enzyme 2 GeneCard ID B2R7I5 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location 12
Enzyme 2 Locus 12q24
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 16948
Enzyme 3 Name Probable proline racemase
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name C14orf149
Enzyme 3 Protein Sequence >Probable proline racemase 
MESALAVPWLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDH
VRRRLMFEPRGHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGL
VPAPPAGTREARVNIHCPCGLVTAFVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGK
VMVDIAYGGAFYAFVTAEKLGLDICSAKTRDLVDAASAVTEAVKAQFKINHPDSEDLAFL
YGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKS
SATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK
Enzyme 3 Number of Residues 354
Enzyme 3 Molecular Weight 38168
Enzyme 3 Theoretical pI 6.56
Enzyme 3 GO Classification Not Available
Enzyme 3 General Function Not Available
Enzyme 3 Specific Function Catalyzes the interconversion of L- and D-proline
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein Not Available
Enzyme 3 UniProtKB/Swiss-Prot ID Q96EM0 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name PRCM_HUMAN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence Not Available
Enzyme 3 GenBank Gene ID AK058165 Link Image
Enzyme 3 GeneCard ID Q96EM0 Link Image
Enzyme 3 GenAtlas ID C14orf149 Link Image
Enzyme 3 HGNC ID HGNC:20488 Link Image
Enzyme 3 Chromosome Location 14
Enzyme 3 Locus 14q23.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available