We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for 7 alpha,24-Dihydroxy-4-cholesten-3-one (HMDB12457)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2009-07-13 14:33:13
Update Date 2009-07-28 04:01:26
Accession Number HMDB12457
Secondary Accession Numbers Not Available
Common Name 7 alpha,24-Dihydroxy-4-cholesten-3-one
Description 7 alpha,24-Dihydroxy-4-cholesten-3-one is involved in the primary bile acid biosynthesis pathway. 7 alpha,24-Dihydroxy-4-cholesten-3-one is produced from (24S)-Cholest-5-ene-3 beta,7 alpha,24-triol through the action of HSD3B7 (EC:1.1.1.181).
Synonyms Not Available
Chemical IUPAC Name Not Available
Chemical Formula C27H44O3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
—
Class
—
Sub Class
—
Family
  • Mammalian Metabolite
Species
  • ketone
  • secondary alcohol
  • alkene
Biofunction
—
Application
—
Source
  • Endogenous
Average Molecular Weight 416.637
Monoisotopic Molecular Weight 416.329041
Isomeric SMILES CC(C)C(O)CC[C@@H](C)C1CCC2C3[C@H](O)CC4=CC(=O)CC[C@]4(C)C3CC[C@]12C
Canonical SMILES CC(C)C(O)CCC(C)C1CCC2C3C(O)CC4=CC(=O)CCC4(C)C3CCC12C
KEGG Compound ID C17331 Link Image
BioCyc ID Not Available
BiGG ID Not Available
Wikipedia Link Not Available
NuGOwiki Link HMDB12457 Link Image
Metagene Link HMDB12457 Link Image
METLIN ID Not Available
PubChem Compound Not Available
PubChem Substance Not Available
ChEBI ID Not Available
CAS Registry Number Not Available
InChI Identifier InChI=1/C27H44O3/c1-16(2)23(29)9-6-17(3)20-7-8-21-25-22(11-13-27(20,21)5)26(4)12-10-19(28)14-18(26)15-24(25)30/h14,16-17,20-25,29-30H,6-13,15H2,1-5H3/t17-,20?,21?,22?,23?,24-,25?,26+,27-/m1/s1
Synthesis Reference Not Available
Melting Point (Experimental) Not Available
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility null Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity null Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location Not Available
Biofluid Location Not Available
Tissue Location Not Available
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Associated Disorders Not Available
OMIM ID Not Available
Pathways
Name SMPDB Link KEGG Link
Bile Acid Biosynthesis SMP00035 Link Image map00120 Link Image
General References Not Available
Metabolic Enzymes
  1. 3 beta-hydroxysteroid dehydrogenase type 7
Enzyme 1 [top]
Enzyme 1 ID 10575
Enzyme 1 Name 3 beta-hydroxysteroid dehydrogenase type 7
Enzyme 1 Synonyms
  1. 3 beta-hydroxysteroid dehydrogenase type VII
  2. 3-beta-HSD VII
  3. 3-beta-hydroxy-Delta(5-C27 steroid oxidoreductase
  4. C(273-beta-HSD
Enzyme 1 Gene Name HSD3B7
Enzyme 1 Protein Sequence >3 beta-hydroxysteroid dehydrogenase type 7 
MADSAQAQKLVYLVTGGCGFLGEHVVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRV
TAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQGTRNVIEACVQTG
TRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRG
GLPLVTCALRPTGIYGEGHQIMRDFYRQGLRLGGWLFRAIPASVEHGRVYVGNVAWMHVL
AARELEQRATLMGGQVYFCYDGSPYRSYEDFNMEFLGPCGLRLVGARPLLPYWLLVFLAA
LNALLQWLLRPLVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILW
VQAATGSAQ
Enzyme 1 Number of Residues 369
Enzyme 1 Molecular Weight 41017
Enzyme 1 Theoretical pI Not Available
Enzyme 1 GO Classification
Function
  • 3-beta-hydroxy-delta5-steroid dehydrogenase activity
  • catalytic activity
  • intramolecular oxidoreductase activity
  • intramolecular oxidoreductase activity, transposing C=C bonds
  • isomerase activity
  • oxidoreductase activity
  • oxidoreductase activity, acting on CH-OH group of donors
  • oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
  • steroid dehydrogenase activity
  • steroid delta-isomerase activity
Process
  • cellular lipid metabolism
  • lipid metabolism
  • metabolism
  • physiological process
  • primary metabolism
  • steroid biosynthesis
  • steroid metabolism
Component
—
Enzyme 1 General Function Cell wall/membrane/envelope biogenesis
Enzyme 1 Specific Function The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD VII is active against four 7-alpha-hydroxylated sterols. Does not metabolize several different C(19/21) steroids as substrates. Involved in bile acid synthesis
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions
  • Nicotinamide adenine dinucleotide + 7 alpha-Hydroxycholesterol --> H+ + Nicotinamide adenine dinucleotide - reduced + 7alpha-Hydroxycholest-4-en-3-one
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 289-309 311-331
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 11545403 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q9H2F3 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name 3BHS7_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence Not Available
Enzyme 1 GenBank Gene ID AF277719 Link Image
Enzyme 1 GeneCard ID Not Available
Enzyme 1 GenAtlas ID HSD3B7 Link Image
Enzyme 1 HGNC ID HGNC:18324 Link Image
Enzyme 1 Chromosome Location Not Available
Enzyme 1 Locus Not Available
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. Schwarz M, Wright AC, Davis DL, Nazer H, Bjorkhem I, Russell DW: The bile acid synthetic gene 3beta-hydroxy-Delta(5)-C(27)-steroid oxidoreductase is mutated in progressive intrahepatic cholestasis. J Clin Invest. 2000 Nov;106(9):1175-84. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available