Showing Protein Cardiac phospholamban (HMDBP02625)

• 8124

1. PLB

• Acebutolol Action Pathway
• Alprenolol Action Pathway
• Amiodarone Action Pathway
• Amlodipine Action Pathway
• Arbutamine Action Pathway
• Atenolol Action Pathway
• Betaxolol Action Pathway
• Bevantolol Action Pathway
• Bisoprolol Action Pathway
• Bopindolol Action Pathway
• Bupranolol Action Pathway
• Carteolol Action Pathway
• Carvedilol Action Pathway
• Diltiazem Action Pathway
• Disopyramide Action Pathway
• Dobutamine Action Pathway
• Epinephrine Action Pathway
• Esmolol Action Pathway
• Felodipine Action Pathway
• Flecainide Action Pathway
• Fosphenytoin (Antiarrhythmic) Action Pathway
• Ibutilide Action Pathway
• Isoprenaline Action Pathway
• Isradipine Action Pathway
• Labetalol Action Pathway
• Levobunolol Action Pathway
• Lidocaine (Antiarrhythmic) Action Pathway
• Metipranolol Action Pathway
• Metoprolol Action Pathway
• Mexiletine Action Pathway
• Muscle/Heart Contraction
• Nadolol Action Pathway
• Nebivolol Action Pathway
• Nifedipine Action Pathway
• Nimodipine Action Pathway
• Nisoldipine Action Pathway
• Nitrendipine Action Pathway
• Oxprenolol Action Pathway
• Penbutolol Action Pathway
• Phenytoin (Antiarrhythmic) Action Pathway
• Pindolol Action Pathway
• Practolol Action Pathway
• Procainamide (Antiarrhythmic) Action Pathway
• Propranolol Action Pathway
• Quinidine Action Pathway
• Sotalol Action Pathway
• Timolol Action Pathway
• Tocainide Action Pathway
• Verapamil Action Pathway

1. Mitochondrion membrane
2. Single-pass membrane protein
3. Sarcoplasmic reticulum

>159 bp
ATGGAGAAAGTCCAATACCTCACTCGCTCAGCTATAAGAAGAGCCTCAACCATTGAAATG
CCTCAACAAGCACGTCAAAAGCTACAGAATCTATTTATCAATTTCTGTCTCATCTTAATA
TGTCTCTTGCTGATCTGTATCATCGTGATGCTTCTCTGA

• Phospholamban (PF04272 )

• None

• 32-52

>Cardiac phospholamban
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

• 1FJK

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
2. Fujii J, Zarain-Herzberg A, Willard HF, Tada M, MacLennan DH: Structure of the rabbit phospholamban gene, cloning of the human cDNA, and assignment of the gene to human chromosome 6. J Biol Chem. 1991 Jun 25;266(18):11669-75. [PubMed:1828805 ]
3. McTiernan CF, Frye CS, Lemster BH, Kinder EA, Ogletree-Hughes ML, Moravec CS, Feldman AM: The human phospholamban gene: structure and expression. J Mol Cell Cardiol. 1999 Mar;31(3):679-92. [PubMed:10198197 ]
4. Vafiadaki E, Sanoudou D, Arvanitis DA, Catino DH, Kranias EG, Kontrogianni-Konstantopoulos A: Phospholamban interacts with HAX-1, a mitochondrial protein with anti-apoptotic function. J Mol Biol. 2007 Mar 16;367(1):65-79. Epub 2006 Oct 21. [PubMed:17241641 ]
5. Mortishire-Smith RJ, Pitzenberger SM, Burke CJ, Middaugh CR, Garsky VM, Johnson RG: Solution structure of the cytoplasmic domain of phopholamban: phosphorylation leads to a local perturbation in secondary structure. Biochemistry. 1995 Jun 13;34(23):7603-13. [PubMed:7779806 ]
6. Adams PD, Arkin IT, Engelman DM, Brunger AT: Computational searching and mutagenesis suggest a structure for the pentameric transmembrane domain of phospholamban. Nat Struct Biol. 1995 Feb;2(2):154-62. [PubMed:7749920 ]
7. Herzyk P, Hubbard RE: Using experimental information to produce a model of the transmembrane domain of the ion channel phospholamban. Biophys J. 1998 Mar;74(3):1203-14. [PubMed:9512019 ]
8. Schmitt JP, Kamisago M, Asahi M, Li GH, Ahmad F, Mende U, Kranias EG, MacLennan DH, Seidman JG, Seidman CE: Dilated cardiomyopathy and heart failure caused by a mutation in phospholamban. Science. 2003 Feb 28;299(5611):1410-3. [PubMed:12610310 ]
9. Haghighi K, Kolokathis F, Gramolini AO, Waggoner JR, Pater L, Lynch RA, Fan GC, Tsiapras D, Parekh RR, Dorn GW 2nd, MacLennan DH, Kremastinos DT, Kranias EG: A mutation in the human phospholamban gene, deleting arginine 14, results in lethal, hereditary cardiomyopathy. Proc Natl Acad Sci U S A. 2006 Jan 31;103(5):1388-93. Epub 2006 Jan 23. [PubMed:16432188 ]