Showing Protein Adenosine deaminase CECR1 (HMDBP11629)
Identification | ||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11629 | |||||||||||||||||
Secondary Accession Numbers | None | |||||||||||||||||
Name | Adenosine deaminase CECR1 | |||||||||||||||||
Synonyms |
|
|||||||||||||||||
Gene Name | CECR1 | |||||||||||||||||
Protein Type | Unknown | |||||||||||||||||
Biological Properties | ||||||||||||||||||
General Function | Not Available | |||||||||||||||||
Specific Function | Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity. | |||||||||||||||||
Pathways | Not Available | |||||||||||||||||
Reactions |
|
|||||||||||||||||
GO Classification |
|
|||||||||||||||||
Cellular Location | Not Available | |||||||||||||||||
Gene Properties | ||||||||||||||||||
Chromosome Location | 22 | |||||||||||||||||
Locus | 22q11.2 | |||||||||||||||||
SNPs | Not Available | |||||||||||||||||
Gene Sequence | Not Available | |||||||||||||||||
Protein Properties | ||||||||||||||||||
Number of Residues | Not Available | |||||||||||||||||
Molecular Weight | 58933.1 | |||||||||||||||||
Theoretical pI | 7.907 | |||||||||||||||||
Pfam Domain Function |
|
|||||||||||||||||
Signals | Not Available | |||||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||||
Protein Sequence |
>>gi|29029550|ref|NP_059120.2| adenosine deaminase CECR1 isoform a precursor [Homo sapiens] MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRLVLNTKEELAN ERLMTLKIAE |
|||||||||||||||||
External Links | ||||||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||||||
UniProtKB/Swiss-Prot ID | Q9NZK5 | |||||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||||||
PDB IDs | ||||||||||||||||||
GenBank Gene ID | Not Available | |||||||||||||||||
GeneCard ID | Not Available | |||||||||||||||||
GenAtlas ID | Not Available | |||||||||||||||||
HGNC ID | HGNC:1839 | |||||||||||||||||
References | ||||||||||||||||||
General References | Not Available |