Hmdb loader

Showing Protein Zinc transporter 8 (HMDBP12042)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 0 metabolites
Identification
HMDB Protein ID HMDBP12042
Secondary Accession Numbers None
Name Zinc transporter 8
Synonyms
  1. ZnT-8
  2. Solute carrier family 30 member 8
Gene Name SLC30A8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
response to interleukin-1
positive regulation of insulin secretion
response to interferon-gamma
insulin secretion
response to glucose stimulus
regulation of sequestering of zinc ion
sequestering of zinc ion
regulation of vesicle-mediated transport
Cellular Component
plasma membrane
secretory granule membrane
transport vesicle membrane
integral to membrane
Molecular Function
zinc ion transmembrane transporter activity
zinc ion binding
protein homodimerization activity
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8q24.11
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 35052.755
Theoretical pI 6.96
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|289803003|ref|NP_001166282.1| zinc transporter 8 isoform b [Homo sapiens]
MYHCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLI
DLTSFLLSLF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IWU4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20303
References
General References Not Available