You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00021
Secondary Accession Numbers
  • 5250
Name Arylamine N-acetyltransferase 2
Synonyms
  1. Arylamide acetylase 2
  2. N-acetyltransferase type 2
  3. NAT-2
  4. PNAT
  5. Polymorphic arylamine N-acetyltransferase
Gene Name NAT2
Protein Type Enzyme
Biological Properties
General Function Involved in acetyltransferase activity
Specific Function Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Pathways
  • Caffeine metabolism
  • Caffeine Metabolism
  • Chemical carcinogenesis
  • Drug metabolism - other enzymes
Reactions
Acetyl-CoA + an arylamine → Coenzyme A + an N-acetylarylamine details
Paraxanthine → 5-Acetylamino-6-formylamino-3-methyluracil details
2,4-Diamino-6-nitrotoluene + Acetyl-CoA → 4-Acetamido-2-amino-6-nitrotoluene + Coenzyme A details
Acetyl-CoA + Isoniazid → Coenzyme A + Acetylisoniazid details
Acetyl-CoA + Acetylhydrazine → Coenzyme A + N,N'-Diacetylhydrazine details
GO Classification
Biological Process
small molecule metabolic process
xenobiotic metabolic process
Cellular Component
cytosol
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
Molecular Function
arylamine N-acetyltransferase activity
Process
metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 8
Locus 8p22
SNPs NAT2
Gene Sequence
>873 bp
ATGGACATTGAAGCATATTTTGAAAGAATTGGCTATAAGAACTCTAGGAACAAATTGGAC
TTGGAAACATTAACTGACATTCTTGAGCACCAGATCCGGGCTGTTCCCTTTGAGAACCTT
AACATGCATTGTGGGCAAGCCATGGAGTTGGGCTTAGAGGCTATTTTTGATCACATTGTA
AGAAGAAACCGGGGTGGGTGGTGTCTCCAGGTCAATCAACTTCTGTACTGGGCTCTGACC
ACAATCGGTTTTCAGACCACAATGTTAGGAGGGTATTTTTACATCCCTCCAGTTAACAAA
TACAGCACTGGCATGGTTCACCTTCTCCTGCAGGTGACCACTGACGGCAGGAATTACATT
GTCGATGCTGGGTCTGGAAGCTCCTCCCAGATGTGGCAGCCTCTAGAATTAATTTCTGGG
AAGGATCAGCCTCAGGTGCCTTGCATTTTCTGCTTGACAGAAGAGAGAGGAATCTGGTAC
CTGGACCAAATCAGGAGAGAGCAGTATATTACAAACAAAGAATTTCTTAATTCTCATCTC
CTGCCAAAGAAGAAACACCAAAAAATATACTTATTTACGCTTGAACCTCGAACAATTGAA
GATTTTGAGTCTATGAATACATACCTGCAGACGTCTCCAACATCTTCATTTATAACCACA
TCATTTTGTTCCTTGCAGACCCCAGAAGGGGTTTACTGTTTGGTGGGCTTCATCCTCACC
TATAGAAAATTCAATTATAAAGACAATACAGATCTGGTCGAGTTTAAAACTCTCACTGAG
GAAGAGGTTGAAGAAGTGCTGAAAAATATATTTAAGATTTCCTTGGGGAGAAATCTCGTG
CCCAAACCTGGTGATGGATCCCTTACTATTTAG
Protein Properties
Number of Residues 290
Molecular Weight 33570.245
Theoretical pI 5.86
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Arylamine N-acetyltransferase 2
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIV
RRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYI
VDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHL
LPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILT
YRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI
GenBank ID Protein 2801807
UniProtKB/Swiss-Prot ID P11245
UniProtKB/Swiss-Prot Entry Name ARY2_HUMAN
PDB IDs
GenBank Gene ID AF042740
GeneCard ID NAT2
GenAtlas ID NAT2
HGNC ID HGNC:7646
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Blum M, Grant DM, McBride W, Heim M, Meyer UA: Human arylamine N-acetyltransferase genes: isolation, chromosomal localization, and functional expression. DNA Cell Biol. 1990 Apr;9(3):193-203. [PubMed:2340091 ]
  3. Ohsako S, Deguchi T: Cloning and expression of cDNAs for polymorphic and monomorphic arylamine N-acetyltransferases from human liver. J Biol Chem. 1990 Mar 15;265(8):4630-4. [PubMed:1968463 ]
  4. Patin E, Barreiro LB, Sabeti PC, Austerlitz F, Luca F, Sajantila A, Behar DM, Semino O, Sakuntabhai A, Guiso N, Gicquel B, McElreavey K, Harding RM, Heyer E, Quintana-Murci L: Deciphering the ancient and complex evolutionary history of human arylamine N-acetyltransferase genes. Am J Hum Genet. 2006 Mar;78(3):423-36. Epub 2006 Jan 13. [PubMed:16416399 ]
  5. Ebisawa T, Deguchi T: Structure and restriction fragment length polymorphism of genes for human liver arylamine N-acetyltransferases. Biochem Biophys Res Commun. 1991 Jun 28;177(3):1252-7. [PubMed:1676262 ]
  6. Wu H, Dombrovsky L, Tempel W, Martin F, Loppnau P, Goodfellow GH, Grant DM, Plotnikov AN: Structural basis of substrate-binding specificity of human arylamine N-acetyltransferases. J Biol Chem. 2007 Oct 12;282(41):30189-97. Epub 2007 Jul 26. [PubMed:17656365 ]
  7. Grant DM, Blum M, Demierre A, Meyer UA: Nucleotide sequence of an intronless gene for a human arylamine N-acetyltransferase related to polymorphic drug acetylation. Nucleic Acids Res. 1989 May 25;17(10):3978. [PubMed:2734109 ]
  8. Deguchi T: Sequences and expression of alleles of polymorphic arylamine N-acetyltransferase of human liver. J Biol Chem. 1992 Sep 5;267(25):18140-7. [PubMed:1381364 ]
  9. Ferguson RJ, Doll MA, Rustan TD, Gray K, Hein DW: Cloning, expression, and functional characterization of two mutant (NAT2(191) and NAT2(341/803)) and wild-type human polymorphic N-acetyltransferase (NAT2) alleles. Drug Metab Dispos. 1994 May-Jun;22(3):371-6. [PubMed:7915226 ]
  10. Grant DM, Lottspeich F, Meyer UA: Evidence for two closely related isozymes of arylamine N-acetyltransferase in human liver. FEBS Lett. 1989 Feb 13;244(1):203-7. [PubMed:2924904 ]
  11. Vatsis KP, Martell KJ, Weber WW: Diverse point mutations in the human gene for polymorphic N-acetyltransferase. Proc Natl Acad Sci U S A. 1991 Jul 15;88(14):6333-7. [PubMed:2068113 ]
  12. Abe M, Deguchi T, Suzuki T: The structure and characteristics of a fourth allele of polymorphic N-acetyltransferase gene found in the Japanese population. Biochem Biophys Res Commun. 1993 Mar 31;191(3):811-6. [PubMed:8466518 ]
  13. Lin HJ, Han CY, Lin BK, Hardy S: Ethnic distribution of slow acetylator mutations in the polymorphic N-acetyltransferase (NAT2) gene. Pharmacogenetics. 1994 Jun;4(3):125-34. [PubMed:7920692 ]