You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00064
Secondary Accession Numbers
  • 5293
Name Galactoside-binding soluble lectin 13
Synonyms
  1. Gal-13
  2. Galectin-13
  3. PP13
  4. Placental protein 13
  5. Placental tissue protein 13
Gene Name LGALS13
Protein Type Enzyme
Biological Properties
General Function Involved in sugar binding
Specific Function Has lysophospholipase activity.
Pathways Not Available
Reactions
2-lysophosphatidylcholine + Water → Glycerophosphocholine + a carboxylate details
GO Classification
Biological Process
phospholipid metabolic process
lipid catabolic process
Function
binding
carbohydrate binding
sugar binding
Molecular Function
carbohydrate binding
lysophospholipase activity
carboxylesterase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q13.1
SNPs LGALS13
Gene Sequence
>420 bp
ATGTCTTCTTTACCCGTGCCATACAAACTGCCTGTGTCTTTGTCTGTTGGTTCCTGCGTG
ATAATCAAAGGGACACCAATCCACTCTTTTATCAATGACCCACAGCTGCAGGTGGATTTC
TACACTGACATGGATGAGGATTCAGATATTGCCTTCCGTTTCCGAGTGCACTTTGGCAAT
CATGTGGTCATGAACAGGCGTGAGTTTGGGATATGGATGTTGGAGGAGACAACAGACTAC
GTGCCCTTTGAGGATGGCAAACAATTTGAGCTGTGCATCTACGTACATTACAATGAGTAT
GAGATAAAGGTCAATGGCATACGCATTTACGGCTTTGTCCATCGAATCCCGCCATCATTT
GTGAAGATGGTGCAAGTGTCGAGAGATATCTCCCTGACCTCAGTGTGTGTCTGCAATTGA
Protein Properties
Number of Residues 139
Molecular Weight 16118.44
Theoretical pI 5.737
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Galactoside-binding soluble lectin 13
MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGN
HVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSF
VKMVQVSRDISLTSVCVCN
GenBank ID Protein 6650760
UniProtKB/Swiss-Prot ID Q9UHV8
UniProtKB/Swiss-Prot Entry Name PP13_HUMAN
PDB IDs
GenBank Gene ID AF117383
GeneCard ID LGALS13
GenAtlas ID LGALS13
HGNC ID HGNC:15449
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Than NG, Sumegi B, Than GN, Berente Z, Bohn H: Isolation and sequence analysis of a cDNA encoding human placental tissue protein 13 (PP13), a new lysophospholipase, homologue of human eosinophil Charcot-Leyden Crystal protein. Placenta. 1999 Nov;20(8):703-10. [PubMed:10527825 ]
  3. Bohn H, Kraus W, Winckler W: Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17). Oncodev Biol Med. 1983;4(5):343-50. [PubMed:6856484 ]
  4. Visegrady B, Than NG, Kilar F, Sumegi B, Than GN, Bohn H: Homology modelling and molecular dynamics studies of human placental tissue protein 13 (galectin-13). Protein Eng. 2001 Nov;14(11):875-80. [PubMed:11742106 ]