Hmdb loader

Showing Protein NADH-cytochrome b5 reductase 3 (HMDBP00125)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 5 metabolites
Identification
HMDB Protein ID HMDBP00125
Secondary Accession Numbers
  • 5357
Name NADH-cytochrome b5 reductase 3
Synonyms
  1. B5R
  2. Cytochrome b5 reductase
  3. Diaphorase-1
  4. NADH-cytochrome b5 reductase 3 membrane-bound form
  5. NADH-cytochrome b5 reductase 3 soluble form
Gene Name CYB5R3
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
Pathways
  • Amino sugar and nucleotide sugar metabolism
Reactions
NADH + ferricytochrome b5 → NAD + Hydrogen Ion + ferrocytochrome b5 details
GO Classification
Biological Process
L-ascorbic acid metabolic process
cholesterol biosynthetic process
blood circulation
Cellular Component
endoplasmic reticulum membrane
endoplasmic reticulum
hemoglobin complex
mitochondrial outer membrane
lipid particle
mitochondrial inner membrane
Function
catalytic activity
oxidoreductase activity
Molecular Function
cytochrome-b5 reductase activity
FAD binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Isoform 2:Cytoplasm
Gene Properties
Chromosome Location 22
Locus 22q13.2
SNPs CYB5R3
Gene Sequence 
>906 bp
ATGGGGGCCCAGCTCAGCACGTTGGGCCATATGGTGCTCTTCCCAGTCTGGTTCCTGTAC
AGTCTGCTCATGAAGCTGTTCCAGCGCTCCACGCCAGCCATCACCCTCGAGAGCCCGGAC
ATCAAGTACCCGCTGCGGCTCATCGACCGGGAGATCATCAGCCATGACACCCGGCGCTTC
CGCTTTGCCCTGCCGTCACCCCAGCACATCCTGGGCCTCCCTGTCGGCCAGCACATCTAC
CTCTCGGCTCGAATTGATGGAAACCTGGTCGTCCGGCCCTATACACCCATCTCCAGCGAT
GATGACAAGGGCTTCGTGGACCTGGTCATCAAGGTTTACTTCAAGGACACCCATCCCAAG
TTTCCCGCTGGAGGGAAGATGTCTCAGTACCTGGAGAGCATGCAGATTGGAGACACCATT
GAGTTCCGGGGCCCCAGTGGGCTGCTGGTCTACCAGGGCAAAGGGAAGTTCGCCATCCGA
CCTGACAAAAAGTCCAACCCTATCATCAGGACAGTGAAGTCTGTGGGCATGATCGCGGGA
GGGACAGGCATCACCCCGATGCTGCAGGTGATCCGCGCCATCATGAAGGACCCTGATGAC
CACACTGTGTGCCACCTGCTCTTTGCCAACCAGACCGAGAAGGACATCCTGCTGCGACCT
GAGCTGGAGGAACTCAGGAACAAACATTCTGCACGCTTCAAGCTCTGGTACACGCTGGAC
AGAGCCCCTGAAGCCTGGGACTACGGCCAGGGCTTCGTGAATGAGGAGATGATCCGGGAC
CACCTTCCACCCCCAGAGGAGGAGCCGCTGGTGCTGATGTGTGGCCCCCCACCCATGATC
CAGTACGCCTGCCTTCCCAACCTGGACCACGTGGGCCACCCCACGGAGCGCTGCTTCGTC
TTCTGA
Protein Properties
Number of Residues 301
Molecular Weight 34234.55
Theoretical pI 7.599
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>NADH-cytochrome b5 reductase 3
MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRF
RFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD
RAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFV
F
GenBank ID Protein 1695155
UniProtKB/Swiss-Prot ID P00387
UniProtKB/Swiss-Prot Entry Name NB5R3_HUMAN
PDB IDs
GenBank Gene ID Y09501
GeneCard ID CYB5R3
GenAtlas ID CYB5R3
HGNC ID HGNC:2873
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  5. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  6. Tomatsu S, Kobayashi Y, Fukumaki Y, Yubisui T, Orii T, Sakaki Y: The organization and the complete nucleotide sequence of the human NADH-cytochrome b5 reductase gene. Gene. 1989 Aug 15;80(2):353-61. [PubMed:2479590 ]
  7. Yubisui T, Naitoh Y, Zenno S, Tamura M, Takeshita M, Sakaki Y: Molecular cloning of cDNAs of human liver and placenta NADH-cytochrome b5 reductase. Proc Natl Acad Sci U S A. 1987 Jun;84(11):3609-13. [PubMed:3035541 ]
  8. Murakami K, Yubisui T, Takeshita M, Miyata T: The NH2-terminal structures of human and rat liver microsomal NADH-cytochrome b5 reductases. J Biochem. 1989 Feb;105(2):312-7. [PubMed:2498303 ]
  9. Yubisui T, Miyata T, Iwanaga S, Tamura M, Takeshita M: Complete amino acid sequence of NADH-cytochrome b5 reductase purified from human erythrocytes. J Biochem. 1986 Feb;99(2):407-22. [PubMed:3700359 ]
  10. Yubisui T, Miyata T, Iwanaga S, Tamura M, Yoshida S, Takeshita M, Nakajima H: Amino acid sequence of NADH-cytochrome b5 reductase of human erythrocytes. J Biochem. 1984 Aug;96(2):579-82. [PubMed:6389526 ]
  11. Bulbarelli A, Valentini A, DeSilvestris M, Cappellini MD, Borgese N: An erythroid-specific transcript generates the soluble form of NADH-cytochrome b5 reductase in humans. Blood. 1998 Jul 1;92(1):310-9. [PubMed:9639531 ]
  12. Shirabe K, Yubisui T, Nishino T, Takeshita M: Role of cysteine residues in human NADH-cytochrome b5 reductase studied by site-directed mutagenesis. Cys-273 and Cys-283 are located close to the NADH-binding site but are not catalytically essential. J Biol Chem. 1991 Apr 25;266(12):7531-6. [PubMed:2019583 ]
  13. Bando S, Takano T, Yubisui T, Shirabe K, Takeshita M, Nakagawa A: Structure of human erythrocyte NADH-cytochrome b5 reductase. Acta Crystallogr D Biol Crystallogr. 2004 Nov;60(Pt 11):1929-34. Epub 2004 Oct 20. [PubMed:15502298 ]
  14. Yubisui T, Shirabe K, Takeshita M, Kobayashi Y, Fukumaki Y, Sakaki Y, Takano T: Structural role of serine 127 in the NADH-binding site of human NADH-cytochrome b5 reductase. J Biol Chem. 1991 Jan 5;266(1):66-70. [PubMed:1898726 ]
  15. Katsube T, Sakamoto N, Kobayashi Y, Seki R, Hirano M, Tanishima K, Tomoda A, Takazakura E, Yubisui T, Takeshita M, et al.: Exonic point mutations in NADH-cytochrome B5 reductase genes of homozygotes for hereditary methemoglobinemia, types I and III: putative mechanisms of tissue-dependent enzyme deficiency. Am J Hum Genet. 1991 Apr;48(4):799-808. [PubMed:1707593 ]
  16. Shirabe K, Yubisui T, Borgese N, Tang CY, Hultquist DE, Takeshita M: Enzymatic instability of NADH-cytochrome b5 reductase as a cause of hereditary methemoglobinemia type I (red cell type). J Biol Chem. 1992 Oct 5;267(28):20416-21. [PubMed:1400360 ]
  17. Shirabe K, Fujimoto Y, Yubisui T, Takeshita M: An in-frame deletion of codon 298 of the NADH-cytochrome b5 reductase gene results in hereditary methemoglobinemia type II (generalized type). A functional implication for the role of the COOH-terminal region of the enzyme. J Biol Chem. 1994 Feb 25;269(8):5952-7. [PubMed:8119939 ]
  18. Vieira LM, Kaplan JC, Kahn A, Leroux A: Four new mutations in the NADH-cytochrome b5 reductase gene from patients with recessive congenital methemoglobinemia type II. Blood. 1995 Apr 15;85(8):2254-62. [PubMed:7718898 ]
  19. Jenkins MM, Prchal JT: A high-frequency polymorphism of NADH-cytochrome b5 reductase in African-Americans. Hum Genet. 1997 Feb;99(2):248-50. [PubMed:9048929 ]
  20. Wu YS, Huang CH, Wan Y, Huang QJ, Zhu ZY: Identification of a novel point mutation (Leu72Pro) in the NADH-cytochrome b5 reductase gene of a patient with hereditary methaemoglobinaemia type I. Br J Haematol. 1998 Jul;102(2):575-7. [PubMed:9695975 ]
  21. Higasa K, Manabe JI, Yubisui T, Sumimoto H, Pung-Amritt P, Tanphaichitr VS, Fukumaki Y: Molecular basis of hereditary methaemoglobinaemia, types I and II: two novel mutations in the NADH-cytochrome b5 reductase gene. Br J Haematol. 1998 Dec;103(4):922-30. [PubMed:9886302 ]
  22. Wang Y, Wu YS, Zheng PZ, Yang WX, Fang GA, Tang YC, Xie F, Lan FH, Zhu ZY: A novel mutation in the NADH-cytochrome b5 reductase gene of a Chinese patient with recessive congenital methemoglobinemia. Blood. 2000 May 15;95(10):3250-5. [PubMed:10807796 ]
  23. Huang C, Xie Y, Wang Y, Wu Y, Ye Y, Zhu Z: [Arginine-glutamine replacement at residue 57 of NADH-cytochrome b5 reductase in Chinese hereditary methemoglobinemia]. Zhonghua Xue Ye Xue Za Zhi. 1997 Apr;18(4):200-3. [PubMed:15622768 ]
  24. Percy MJ, Gillespie MJ, Savage G, Hughes AE, McMullin MF, Lappin TR: Familial idiopathic methemoglobinemia revisited: original cases reveal 2 novel mutations in NADH-cytochrome b5 reductase. Blood. 2002 Nov 15;100(10):3447-9. Epub 2002 Jul 5. [PubMed:12393396 ]
  25. Percy MJ, Crowley LJ, Davis CA, McMullin MF, Savage G, Hughes J, McMahon C, Quinn RJ, Smith O, Barber MJ, Lappin TR: Recessive congenital methaemoglobinaemia: functional characterization of the novel D239G mutation in the NADH-binding lobe of cytochrome b5 reductase. Br J Haematol. 2005 Jun;129(6):847-53. [PubMed:15953014 ]