You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00176
Secondary Accession Numbers
  • 5408
Name Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
Synonyms
  1. ETF dehydrogenase
  2. ETF-QO
  3. ETF-ubiquinone oxidoreductase
  4. Electron-transferring-flavoprotein dehydrogenase
Gene Name ETFDH
Protein Type Unknown
Biological Properties
General Function Involved in electron-transferring-flavoprotein dehydrogenase activity
Specific Function Accepts electrons from ETF and reduces ubiquinone.
Pathways Not Available
Reactions
Reduced electron-transferring flavoprotein + Coenzyme Q10 → electron-transferring flavoprotein + QH(2) details
GO Classification
Biological Process
response to oxidative stress
fatty acid beta-oxidation using acyl-CoA dehydrogenase
respiratory electron transport chain
Cellular Component
mitochondrial matrix
integral to mitochondrial inner membrane
Function
catalytic activity
oxidoreductase activity, acting on the ch-nh group of donors
oxidoreductase activity, acting on the ch-nh group of donors, quinone or similar compound as acceptor
electron-transferring-flavoprotein dehydrogenase activity
oxidoreductase activity
Molecular Function
electron carrier activity
metal ion binding
4 iron, 4 sulfur cluster binding
electron-transferring-flavoprotein dehydrogenase activity
oxidoreductase activity, oxidizing metal ions with flavin as acceptor
flavin adenine dinucleotide binding
ubiquinone binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location 4
Locus 4q32-q35
SNPs ETFDH
Gene Sequence
>1854 bp
ATGCTGGTGCCGCTAGCCAAGCTGTCCTGCCTGGCATATCAGTGCTTTCATGCCTTAAAA
ATTAAGAAAAATTATCTACCTCTATGTGCTACAAGATGGTCTTCAACTTCTACTGTGCCT
CGAATTACTACCCATTATACTATTTATCCCCGGGATAAGGACAAGAGATGGGAAGGAGTG
AACATGGAAAGGTTTGCAGAAGAAGCAGATGTTGTAATAGTTGGTGCAGGCCCTGCAGGG
CTCTCTGCAGCTGTTCGTCTAAAACAGTTGGCTGTGGCACATGAAAAGGACATCCGTGTG
TGTCTAGTGGAGAAAGCTGCCCAGATAGGAGCTCATACTCTCTCAGGGGCTTGCCTTGAT
CCAGGTGCTTTTAAAGAACTCTTCCCAGACTGGAAAGAGAAGGGGGCTCCACTTAACACT
CCTGTAACAGAAGACAGATTTGGAATTTTAACAGAGAAATACAGAATTCCTGTGCCAATT
CTTCCAGGGCTTCCAATGAATAATCATGGCAATTACATTGTACGCTTGGGACATTTAGTG
AGCTGGATGGGCGAACAAGCAGAAGCCCTTGGTGTTGAAGTATACCCTGGTTATGCAGCT
GCTGAGGTCCTTTTTCATGATGATGGTAGTGTAAAAGGAATTGCCACTAACGATGTAGGG
ATACAAAAGGATGGTGCACCAAAGGCAACATTTGAGAGAGGACTGGAACTACATGCTAAA
GTCACAATTTTTGCAGAAGGTTGCCATGGACATCTAGCCAAGCAACTATATAAGAAGTTT
GATTTGAGAGCAAATTGTGAACCTCAAACCTACGGGATTGGACTGAAGGAGTTATGGGTT
ATTGATGAAAAGAACTGGAAACCTGGGAGAGTAGATCACACTGTTGGTTGGCCCTTGGAC
AGACATACCTATGGAGGATCTTTCCTCTATCATTTGAATGAAGGTGAACCCCTAGTAGCT
CTTGGTCTTGTGGTTGGTCTAGACTATCAGAATCCATACCTGAGTCCATTTAGAGAGTTC
CAAAGGTGGAAACACCATCCTAGCATTCGGCCAACCTTGGAAGGTGGAAAAAGGATTGCA
TACGGAGCCAGAGCTCTCAATGAAGGTGGCTTTCAGTCTATACCAAAACTCACCTTTCCT
GGTGGTTTACTAATTGGTTGTAGTCCTGGTTTTATGAATGTTCCCAAGATCAAAGGTACT
CACACAGCAATGAAAAGTGGAATTTTAGCAGCAGAATCTATTTTTAATCAACTAACTAGT
GAAAATCTCCAATCAAAGACAATAGGACTCCATGTAACTGAATATGAGGACAATTTGAAG
AACTCATGGGTATGGAAAGAGCTATATTCTGTTAGAAATATAAGACCGTCCTGCCACGGA
GTACTGGGTGTATATGGAGGGATGATTTACACTGGAATCTTTTACTGGATATTGAGAGGA
ATGGAGCCGTGGACTCTGAAACATAAAGGTTCTGACTTTGAACGGCTCAAGCCAGCCAAG
GATTGCACACCTATTGAGTATCCAAAACCCGATGGACAGATCAGTTTTGACCTCTTGTCA
TCTGTGGCTCTGAGTGGTACTAATCATGAACATGACCAGCCGGCACACTTAACCTTAAGG
GATGACAGTATACCTGTAAATAGAAATCTGTCGATATATGATGGGCCCGAGCAGCGATTC
TGTCCTGCAGGAGTTTATGAATTTGTACCTGTGGAACAAGGTGATGGATTTCGGTTACAG
ATAAATGCTCAGAACTGTGTACATTGTAAAACATGTGATATTAAAGATCCAAGTCAGAAT
ATTAACTGGGTGGTACCTGAAGGTGGAGGAGGACCTGCTTACAATGGAATGTAA
Protein Properties
Number of Residues 617
Molecular Weight 68494.96
Theoretical pI 7.554
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
MLVPLAKLSCLAYQCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLD
PGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRG
MEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLR
DDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM
GenBank ID Protein 119703746
UniProtKB/Swiss-Prot ID Q16134
UniProtKB/Swiss-Prot Entry Name ETFD_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004453.2
GeneCard ID ETFDH
GenAtlas ID ETFDH
HGNC ID HGNC:3483
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Goodman SI, Axtell KM, Bindoff LA, Beard SE, Gill RE, Frerman FE: Molecular cloning and expression of a cDNA encoding human electron transfer flavoprotein-ubiquinone oxidoreductase. Eur J Biochem. 1994 Jan 15;219(1-2):277-86. [PubMed:8306995 ]