You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00177
Secondary Accession Numbers
  • 5409
  • HMDBP03463
Name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
Synonyms
  1. CI-39kD
  2. Complex I-39kD
  3. NADH-ubiquinone oxidoreductase 39 kDa subunit
Gene Name NDUFA9
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
Process
metabolic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 12p13.3
SNPs NDUFA9
Gene Sequence
>1134 bp
ATGGCGGCTGCCGCACAATCCCGGGTTGTCCGGGTCCTGTCAATGTCACGTTCTGCCATT
ACTGCAATAGCCACATCTGTGTGTCACGGCCCACCCTGTCGCCAGCTTCATCATGCCCTC
ATGCCTCATGGGAAAGGTGGACGTTCCTCAGTCAGTGGGATTGTGGCCACTGTGTTTGGA
GCAACAGGATTCCTGGGGCGATATGTTGTCAACCACCTTGGACGCATGGGGTCACAGGTA
ATCATACCCTATCGGTGTGATAAATATGACATCATGCACCTTCGTCCCATGGGTGACCTG
GGCCAGCTTCTGTTTCTGGAATGGGACGCGAGAGATAAAGATTCTATCCGACGAGTAGTA
CAACACAGCAATGTGGTCATCAATCTTATTGGACGAGACTGGGAAACCAAAAACTTTGAT
TTTGAGGATGTTTTTGTGAAGATTCCCCAAGCAATTGCTCAACTGTCCAAGGAAGCTGGA
GTTGAAAAATTCATTCATGTTTCACATCTGAATGCGAATATTAAAAGCTCTTCTAGATAT
TTGAGAAATAAGGCTGTTGGAGAGAAAGTAGTGAGAGATGCATTTCCGGAAGCCATTATC
GTAAAGCCGTCGGACATCTTTGGAAGAGAGGATAGATTCCTTAATTCTTTTGCAAGTATG
CATCGGTTTGGTCCTATACCCCTTGGTTCCTTGGGCTGGAAGACAGTTAAACAACCAGTA
TATGTCGTAGATGTATCCAAAGGAATTGTTAATGCAGTTAAGGATCCTGATGCCAATGGG
AAATCCTTTGCTTTCGTTGGTCCCAGTCGGTACCTCCTTTTCCACCTGGTGAAGTACATC
TTTGCTGTGGCTCACAGATTGTTCCTCCCATTCCCCTTGCCGCTTTTTGCCTATCGATGG
GTAGCAAGAGTCTTTGAAATAAGCCCATTTGAGCCCTGGATAACAAGGGATAAAGTGGAG
CGGATGCACATCACAGACATGAAATTGCCTCACCTGCCTGGCTTAGAAGACCTTGGTATT
CAGGCAACACCACTGGAACTCAAGGCCATTGAGGTGCTGCGGCGTCATCGCACTTACCGC
TGGCTGTCTGCTGAAATTGAGGATGTGAAGCCGGCCAAGACCGTCAACATTTAG
Protein Properties
Number of Residues 377
Molecular Weight 42509.2
Theoretical pI 10.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV
QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRY
LRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV
YVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRW
VARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYR
WLSAEIEDVKPAKTVNI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q16795
UniProtKB/Swiss-Prot Entry Name NDUA9_HUMAN
PDB IDs Not Available
GenBank Gene ID AF050641
GeneCard ID NDUFA9
GenAtlas ID NDUFA9
HGNC ID HGNC:7693
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Murray J, Zhang B, Taylor SW, Oglesbee D, Fahy E, Marusich MF, Ghosh SS, Capaldi RA: The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification. J Biol Chem. 2003 Apr 18;278(16):13619-22. Epub 2003 Feb 28. [PubMed:12611891 ]
  3. Cross SH, Charlton JA, Nan X, Bird AP: Purification of CpG islands using a methylated DNA binding column. Nat Genet. 1994 Mar;6(3):236-44. [PubMed:8012384 ]
  4. Baens M, Chaffanet M, Cassiman JJ, van den Berghe H, Marynen P: Construction and evaluation of a hncDNA library of human 12p transcribed sequences derived from a somatic cell hybrid. Genomics. 1993 Apr;16(1):214-8. [PubMed:8486360 ]