You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00185
Secondary Accession Numbers
  • 5417
Name Dimethylaniline monooxygenase [N-oxide-forming] 1
Synonyms
  1. Dimethylaniline oxidase 1
  2. FMO 1
  3. Fetal hepatic flavin-containing monooxygenase 1
Gene Name FMO1
Protein Type Unknown
Biological Properties
General Function Involved in flavin-containing monooxygenase activity
Specific Function This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines.
Pathways
  • Drug metabolism - cytochrome P450
  • Tamoxifen Action Pathway
  • Tamoxifen Metabolism Pathway
Reactions
N,N-Dimethylaniline + NADPH + Oxygen → Dimethylaniline-N-oxide + NADP + Water details
Trimethylamine + NADPH + Hydrogen Ion + Oxygen → Trimethylamine N-oxide + NADP + Water details
Tamoxifen + Oxygen + NADPH + Hydrogen Ion → Tamoxifen N-oxide + NADP + Water details
GO Classification
Biological Process
toxin metabolic process
response to lipopolysaccharide
xenobiotic metabolic process
organic acid metabolic process
NADPH oxidation
response to osmotic stress
Cellular Component
intrinsic to endoplasmic reticulum membrane
endoplasmic reticulum lumen
integral to membrane
Component
cell part
membrane part
intrinsic to membrane
intrinsic to organelle membrane
intrinsic to endoplasmic reticulum membrane
Function
binding
nucleotide binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
nadp or nadph binding
monooxygenase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, nadh or nadph as one donor, and incorporation of one atom of oxygen
flavin-containing monooxygenase activity
oxidoreductase activity
fad or fadh2 binding
Molecular Function
NADP binding
flavin adenine dinucleotide binding
N,N-dimethylaniline monooxygenase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Microsome membrane
Gene Properties
Chromosome Location 1
Locus 1q24.3
SNPs FMO1
Gene Sequence
>1599 bp
ATGGCCAAGCGAGTTGCCATTGTGGGAGCTGGGGTCAGCGGCCTGGCCTCCATCAAGTGC
TGTCTGGAAGAAGGACTGGAGCCCACCTGCTTTGAGAGGAGCGATGACCTTGGGGGGCTG
TGGAGATTCACCGAACATGTTGAAGAAGGCAGAGCCAGTCTCTACAAGTCTGTGGTTTCC
AACAGCTGCAAGGAGATGTCTTGTTACTCAGACTTTCCATTCCCAGAAGATTATCCAAAC
TATGTGCCAAATTCTCAATTCCTGGAATATCTCAAAATGTATGCAAACCACTTTGACCTT
CTGAAACACATTCAATTCAAGACCAAAGTCTGCAGTGTAACAAAATGCTCAGATTCTGCT
GTCTCTGGCCAATGGGAGGTGGTCACTATGCATGAAGAGAAGCAAGAGTCAGCCATCTTT
GATGCTGTCATGGTCTGCACTGGCTTTCTTACTAATCCTTATTTGCCACTGGATTCCTTT
CCAGGTATTAATGCCTTTAAAGGCCAGTACTTTCATAGCCGGCAATATAAGCATCCAGAT
ATATTTAAGGACAAGAGAGTCCTTGTGATTGGAATGGGAAATTCTGGCACAGACATTGCT
GTGGAGGCCAGCCACCTGGCGGAAAAGGTGTTCCTCAGCACCACCGGAGGGGGATGGGTG
ATCAGCCGAATCTTTGACTCGGGCTACCCATGGGACATGGTGTTCATGACACGCTTTCAG
AACATGTTGAGAAATTCCCTCCCAACCCCAATTGTGACTTGGTTGATGGAGCGAAAGATA
AACAACTGGCTCAATCATGCAAATTACGGCTTAATACCAGAAGACAGGACTCAGCTGAAA
GAGTTTGTGCTAAATGATGAGCTCCCAGGACGCATCATCACTGGGAAAGTGTTCATCAGG
CCAAGCATAAAAGAGGTAAAGGAAAACTCTGTCATATTTAACAATACTTCAAAGGAAGAG
CCTATTGACATCATTGTCTTTGCCACTGGATACACATTTGCTTTCCCCTTCCTTGATGAG
TCTGTAGTGAAAGTTGAAGATGGCCAGGCCTCACTGTACAAGTATATCTTCCCTGCACAT
CTGCAAAAGCCAACCCTGGCCATTATTGGCCTCATCAAACCCTTGGGCTCCATGATACCT
ACAGGAGAAACACAAGCTCGGTGGGCTGTTCGAGTCCTGAAAGGTGTAAATAAGTTACCA
CCACCAAGTGTCATGATAGAGGAAATTAATGCAAGGAAAGAAAACAAGCCCAGTTGGTTT
GGCTTGTGCTACTGCAAGGCTTTACAATCAGATTATATCACATACATAGATGAACTCCTG
ACCTATATCAATGCAAAACCCAACCTGTTCTCTATGCTCCTAACGGATCCACATCTGGCT
CTGACCGTCTTCTTTGGCCCATGCTCACCATACCAGTTCCGCTTGACTGGCCCAGGAAAA
TGGGAAGGAGCCAGAAATGCCATCATGACCCAGTGGGACCGAACATTCAAGGTCATCAAA
GCTCGAGTTGTACAAGAGTCTCCATCTCCCTTTGAAAGTTTTCTTAAAGTCTTTAGCTTT
CTGGCTTTGCTTGTGGCTATTTTTCTGATTTTCCTATAA
Protein Properties
Number of Residues 532
Molecular Weight 60310.285
Theoretical pI 7.201
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dimethylaniline monooxygenase [N-oxide-forming] 1
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
GenBank ID Protein 182671
UniProtKB/Swiss-Prot ID Q01740
UniProtKB/Swiss-Prot Entry Name FMO1_HUMAN
PDB IDs Not Available
GenBank Gene ID M64082
GeneCard ID FMO1
GenAtlas ID FMO1
HGNC ID HGNC:3769
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Furnes B, Feng J, Sommer SS, Schlenk D: Identification of novel variants of the flavin-containing monooxygenase gene family in African Americans. Drug Metab Dispos. 2003 Feb;31(2):187-93. [PubMed:12527699 ]
  5. Dolphin C, Shephard EA, Povey S, Palmer CN, Ziegler DM, Ayesh R, Smith RL, Phillips IR: Cloning, primary sequence, and chromosomal mapping of a human flavin-containing monooxygenase (FMO1). J Biol Chem. 1991 Jul 5;266(19):12379-85. [PubMed:1712018 ]