You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00214
Secondary Accession Numbers
  • 5446
  • HMDBP04859
Name Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
Synonyms
  1. D-fructose-6-phosphate amidotransferase 2
  2. GFAT 2
  3. GFAT2
  4. Glutamine:fructose 6 phosphate amidotransferase 2
  5. Hexosephosphate aminotransferase 2
  6. Glutamine:fructose-6-phosphate amidotransferase 2
Gene Name GFPT2
Protein Type Enzyme
Biological Properties
General Function Involved in metabolic process
Specific Function Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.
Pathways
  • Alanine, aspartate and glutamate metabolism
  • Amino sugar and nucleotide sugar metabolism
  • UDP-N-acetyl-alpha-D-glucosamine biosynthesis
Reactions
L-Glutamine + Fructose 6-phosphate → L-Glutamic acid + Glucosamine 6-phosphate details
GO Classification
Biological Process
glutamine metabolic process
dolichol-linked oligosaccharide biosynthetic process
post-translational protein modification
protein N-linked glycosylation via asparagine
UDP-N-acetylglucosamine biosynthetic process
carbohydrate biosynthetic process
fructose 6-phosphate metabolic process
energy reserve metabolic process
Cellular Component
cytosol
Component
cell part
intracellular part
cytoplasm
Function
binding
catalytic activity
transferase activity
transferase activity, transferring nitrogenous groups
transaminase activity
glutamine-fructose-6-phosphate transaminase (isomerizing) activity
carbohydrate binding
sugar binding
Molecular Function
carbohydrate binding
glutamine-fructose-6-phosphate transaminase (isomerizing) activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
carbohydrate biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q34-q35
SNPs GFPT2
Gene Sequence
>2049 bp
ATGTGCGGAATCTTTGCCTACATGAACTACAGAGTCCCCCGGACGAGGAAGGAGATCTTC
GAAACCCTCATCAAGGGCCTGCAGCGGCTGGAGTACAGAGGCTACGACTCGGCAGGTGTG
GCGATCGATGGGAATAATCACGAAGTCAAAGAAAGACACATTCAGCTGGTCAAGAAAAGG
GGGAAAGTCAAGGCTCTCGATGAAGAACTTTACAAACAAGACAGCATGGACTTAAAAGTG
GAGTTTGAGACACACTTCGGCATTGCCCACACGCGCTGGGCCACCCACGGGGTCCCCAGT
GCTGTCAACAGCCACCCTCAGCGCTCAGACAAAGGCAACGAATTTGTTGTCATCCACAAT
GGGATCATCACAAATTACAAAGATCTGAGGAAATTTCTGGAAAGCAAAGGCTACGAGTTT
GAGTCAGAAACAGATACAGAGACCATCGCCAAGCTGATTAAATATGTGTTCGACAACAGA
GAAACTGAGGACATTACGTTTTCAACGTTGGTCGAGAGAGTCATTCAGCAGTTGGAAGGT
GCATTCGCGCTGGTTTTCAAGAGTGTCCACTACCCAGGAGAAGCCGTTGCCACACGGAGA
GGCAGCCCCCTGCTCATCGGAGTCCGGAGCAAATACAAGCTCTCCACAGAACAGATCCCT
ATCTTATACAGGACGTGCACTCTGGAGAATGTGAAGAATATCTGTAAGACACGGATGAAG
AGGCTGGACAGCTCCGCCTGCCTGCATGCTGTGGGCGACAAGGCCGTGGAATTCTTCTTT
GCTTCTGATGCAAGCGCTATCATAGAGCACACCAACCGGGTCATCTTCCTGGAGGACGAT
GACATCGCCGCAGTGGCTGATGGGAAACTCTCCATTCACCGGGTCAAGCGCTCGGCCAGT
GATGACCCATCTCGAGCCATCCAGACCTTGCAGATGGAACTGCAGCAAATCATGAAAGGT
AACTTCAGTGCGTTTATGCAGAAGGAGATCTTCGAACAGCCAGAATCAGTTTTCAATACT
ATGAGAGGTCGGGTGAATTTTGAAACCAACACAGTGCTCCTGGGTGGCTTGAAGGACCAC
TTGAAGGAGATTCGACGATGCCGACGGCTCATCGTGATTGGCTGTGGAACCAGCTACCAC
GCTGCCGTGGCTACGCGGCAAGTTTTGGAGGAACTGACTGAGCTTCCTGTGATGGTTGAA
CTTGCTAGTGATTTTCTGGACAGGAACACACCTGTGTTCAGGGATGACGTTTGCTTTTTC
ATCAGCCAGTCAGGCGAGACCGCGGACACCCTCCTGGCGCTGCGCTACTGTAAGGACCGC
GGCGCTCTCACCGTGGGCGTCACCAACACCGTGGGCAGCTCCATCTCTCGCGAGACCGAC
TGCGGCGTCCACATCAACGCAGGGCCGGAGATCGGCGTGGCCAGCACCAAGGCTTATACC
AGTCAGTTCATCTCTCTGGTGATGTTTGGTTTGATGATGTCTGAAGACCGAATTTCACTA
CAAAACAGGAGGCAAGAGATCATCCGTGGCTTGAGATCTTTACCTGAGCTGATCAAGGAA
GTGCTGTCTCTGGAGGAGAAGATCCACGACTTGGCCCTGGAGCTCTACACGCAGAGATCG
CTGCTGGTGATGGGGCGGGGCTACAACTATGCCACCTGCCTGGAAGGAGCCCTGAAAATT
AAAGAGATAACCTACATGCACTCAGAAGGCATCCTGGCTGGGGAGCTGAAGCACGGGCCC
CTGGCACTGATTGACAAGCAGATGCCCGTCATCATGGTCATTATGAAGGATCCTTGCTTC
GCCAAATGCCAGAACGCCCTGCAGCAAGTCACGGCCCGCCAGGGTCGCCCCATTATACTG
TGCTCCAAGGACGATACTGAAAGTTCCAAGTTTGCGTATAAGACAATTGAGCTGCCCCAC
ACTGTGGACTGCCTCCAGGGCATCCTGAGCGTGATTCCGCTGCAGCTGCTGTCCTTCCAC
CTGGCTGTTCTCCGAGGATATGACGTTGACTTCCCCAGAAATCTGGCCAAGTCTGTAACT
GTGGAATGA
Protein Properties
Number of Residues 682
Molecular Weight 76929.885
Theoretical pI 7.377
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMK
RLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O94808
UniProtKB/Swiss-Prot Entry Name GFPT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB016789
GeneCard ID GFPT2
GenAtlas ID GFPT2
HGNC ID HGNC:4242
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Oki T, Yamazaki K, Kuromitsu J, Okada M, Tanaka I: cDNA cloning and mapping of a novel subtype of glutamine:fructose-6-phosphate amidotransferase (GFAT2) in human and mouse. Genomics. 1999 Apr 15;57(2):227-34. [PubMed:10198162 ]