You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00286
Secondary Accession Numbers
  • 5518
Name Carbohydrate sulfotransferase 11
Synonyms
  1. C4S-1
  2. C4ST-1
  3. C4ST1
  4. Chondroitin 4-O-sulfotransferase 1
  5. Chondroitin 4-sulfotransferase 1
Gene Name CHST11
Protein Type Enzyme
Biological Properties
General Function Involved in sulfotransferase activity
Specific Function Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues in desulfated dermatan sulfate. Preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
Pathways
  • Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
  • Sulfate/Sulfite Metabolism
  • Sulfite oxidase deficiency
  • sulfur metabolism
Reactions
Phosphoadenosine phosphosulfate + Chondroitin → Adenosine 3',5'-diphosphate + chondroitin 4'-sulfate details
Phosphoadenosine phosphosulfate + Chondroitin → Adenosine 3',5'-diphosphate + Chondroitin 4-sulfate details
GO Classification
Biological Process
chondroitin sulfate biosynthetic process
regulation of cell proliferation
negative regulation of apoptotic process
developmental growth
respiratory gaseous exchange
carbohydrate biosynthetic process
chondrocyte development
embryonic viscerocranium morphogenesis
negative regulation of transforming growth factor beta receptor signaling pathway
polysaccharide localization
carbohydrate metabolic process
embryonic digit morphogenesis
post-embryonic development
Cellular Component
integral to membrane
Golgi membrane
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfotransferase activity
Molecular Function
chondroitin 4-sulfotransferase activity
N-acetylgalactosamine 4-O-sulfotransferase activity
N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
carbohydrate biosynthetic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 12
Locus 12q
SNPs CHST11
Gene Sequence
>1059 bp
ATGAAGCCAGCGCTGCTGGAAGTGATGAGGATGAACAGAATCTGCCGGATGGTGCTGGCC
ACTTGCTTGGGATCCTTTATCCTGGTCATCTTCTATTTCCAAAGTATGTTGCACCCAGTC
ATGCGGAGGAATCCCTTTGGTGTGGACATCTGCTGCCGGAAGGGGTCCCGAAGCCCCCTG
CAGGAACTCTACAACCCAATCCAGCTGGAGCTCTCAAACACTGCTGTCCTGCACCAGATG
CGGCGGGACCAGGTGACAGACACGTGCCGAGCCAACAGCGCCACAAGCCGTAAGCGGAGG
GTGCTGACCCCCAACGACCTGAAGCACTTGGTGGTGGATGAGGACCACGAGCTCATCTAC
TGCTACGTGCCCAAGGTGGCCTGCACCAACTGGAAGCGGCTCATGATGGTCCTGACCGGG
CGGGGGAAGTACAGCGACCCCATGGAGATCCCGGCCAACGAGGCACACGTCTCCGCCAAC
CTGAAGACCCTGAACCAGTACAGCATCCCAGAAATCAACCACCGCTTGAAAAGCTACATG
AAGTTCCTGTTTGTCCGGGAGCCCTTCGAGAGGCTAGTGTCCGCCTACCGCAACAAGTTC
ACCCAGAAGTACAACATCTCCTTCCACAAGCGGTACGGCACCAAGATCATCAAACGCCAG
CGGAAGAACGCCACCCAGGAGGCCCTGCGCAAAGGGGACGATGTCAAATTCGAGGAGTTT
GTGGCCTATCTCATCGACCCACACACCCAGCGGGAGGAGCCTTTCAACGAACACTGGCAA
ACCGTCTACTCACTCTGCCATCCCTGCCACATCCACTATGACCTCGTGGGCAAGTACGAG
ACACTGGAAGAGGATTCTAATTACGTCCTGCAGCTGGCAGGAGTGGGCAGCTACCTGAAG
TTCCCCACCTATGCAAAGTCTACGAGAACTACTGATGAAATGACCACAGAATTCTTCCAG
AACATCAGCTCAGAGCACCAAACGCAGCTGTACGAAGTCTACAAACTCGATTTTTTAATG
TTCAATTACTCAGTGCCAAGCTACCTGAAATTGGAATAA
Protein Properties
Number of Residues 352
Molecular Weight 41002.97
Theoretical pI 8.853
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carbohydrate sulfotransferase 11
MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPL
QELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIY
CYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYM
KFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEF
VAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLK
FPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE
GenBank ID Protein 7768662
UniProtKB/Swiss-Prot ID Q9NPF2
UniProtKB/Swiss-Prot Entry Name CHSTB_HUMAN
PDB IDs Not Available
GenBank Gene ID AB042326
GeneCard ID CHST11
GenAtlas ID CHST11
HGNC ID HGNC:17422
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Okuda T, Mita S, Yamauchi S, Matsubara T, Yagi F, Yamamori D, Fukuta M, Kuroiwa A, Matsuda Y, Habuchi O: Molecular cloning, expression, and chromosomal mapping of human chondroitin 4-sulfotransferase, whose expression pattern in human tissues is different from that of chondroitin 6-sulfotransferase. J Biochem. 2000 Nov;128(5):763-70. [PubMed:11056388 ]
  4. Hiraoka N, Nakagawa H, Ong E, Akama TO, Fukuda MN, Fukuda M: Molecular cloning and expression of two distinct human chondroitin 4-O-sulfotransferases that belong to the HNK-1 sulfotransferase gene family. J Biol Chem. 2000 Jun 30;275(26):20188-96. [PubMed:10781601 ]
  5. Mikami T, Mizumoto S, Kago N, Kitagawa H, Sugahara K: Specificities of three distinct human chondroitin/dermatan N-acetylgalactosamine 4-O-sulfotransferases demonstrated using partially desulfated dermatan sulfate as an acceptor: implication of differential roles in dermatan sulfate biosynthesis. J Biol Chem. 2003 Sep 19;278(38):36115-27. Epub 2003 Jul 7. [PubMed:12847091 ]
  6. Schmidt HH, Dyomin VG, Palanisamy N, Itoyama T, Nanjangud G, Pirc-Danoewinata H, Haas OA, Chaganti RS: Deregulation of the carbohydrate (chondroitin 4) sulfotransferase 11 (CHST11) gene in a B-cell chronic lymphocytic leukemia with a t(12;14)(q23;q32). Oncogene. 2004 Sep 9;23(41):6991-6. [PubMed:15273723 ]
  7. Yusa A, Kitajima K, Habuchi O: N-linked oligosaccharides are required to produce and stabilize the active form of chondroitin 4-sulphotransferase-1. Biochem J. 2005 May 15;388(Pt 1):115-21. [PubMed:15628971 ]