You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00312
Secondary Accession Numbers
  • 5547
  • HMDBP03199
Name Carnitine O-palmitoyltransferase 1, brain isoform
Synonyms
  1. CPT IC
  2. CPT1-B
  3. CPTI-B
  4. Carnitine O-palmitoyltransferase I, brain isoform
  5. Carnitine palmitoyltransferase 1C
Gene Name CPT1C
Protein Type Enzyme
Biological Properties
General Function Involved in acyltransferase activity
Specific Function Not Available
Pathways
  • Adipocytokine signaling pathway
  • fatty acid beta-oxidation
  • fatty acid metabolism
  • PPAR signaling pathway
Reactions
hexadecanoyl-CoA + L-Carnitine → Coenzyme A + L-Palmitoylcarnitine details
GO Classification
Biological Process
carnitine metabolic process
fatty acid beta-oxidation
Cellular Component
endoplasmic reticulum membrane
cell junction
synapse
mitochondrial outer membrane
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
transferase activity, transferring groups other than amino-acyl groups
Molecular Function
carnitine O-palmitoyltransferase activity
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
  3. Mitochondrion outer membrane
Gene Properties
Chromosome Location 19
Locus 19q13.33
SNPs CPT1C
Gene Sequence
>2412 bp
ATGGCTGAAGCGCACCAGGCCGTGGGCTTCCGACCCTCGCTGACCTCGGACGGGGCTGAA
GTGGAACTCAGTGCCCCTGTGCTGCAGGAGATCTACCTCTCTGGCCTGCGCTCCTGGAAA
AGGCATCTCTCACGTTTCTGGAATGACTTTCTCACCGGTGTGTTTCCTGCCAGCCCCCTC
AGTTGGCTTTTCCTCTTCAGTGCCATCCAGCTTGCCTGGTTCCTCCAGCTGGATCCTTCC
TTAGGACTGATGGAGAAGATCAAAGAGTTGCTGCCTGACTGGGGTGGACAACACCACGGG
CTCCGGGGGGTCCTGGCAGCCGCGCTGTTTGCCTCGTGTTTGTGGGGAGCCCTGATCTTC
ACACTGCACGTGGCCCTGAGGCTGCTTCTGTCCTACCACGGCTGGCTTCTTGAGCCCCAC
GGAGCCATGTCCTCCCCCACCAAGACCTGGCTGGCCCTGGTCCGCATCTTCTCTGGCCGC
CACCCGATGCTGTTCAGTTACCAGCGCTCCCTGCCACGCCAGCCCGTGCCCTCTGTGCAG
GACACCGTGCGCAAGTACCTGGAGTCGGTCCGGCCCATCCTCTCCGACGAGGACTTCGAC
TGGACCGCGGTCCTGGCGCAGGAATTCCTGAGGCTGCAGGCGTCGCTGCTGCAGTGGTAC
CTGCGGCTCAAGTCCTGGTGGGCGTCCAATTATGTCAGTGACTGGTGGGAGGAATTTGTG
TACCTGCGCTCCCGAAATCCGCTGATGGTGAACAGCAACTATTACATGATGGACTTCCTG
TATGTCACACCCACGCCTCTGCAGGCAGCTCGCGCTGGGAATGCCGTCCATGCCCTCCTC
CTGTACCGCCACCGCCTGAACCGCCAGGAGATACCCCCGACTTTGCTGATGGGAATGCGC
CCCTTATGCTCTGCCCAGTACGAGAAGATCTTCAACACCACGCGGATTCCAGGGGTCCAA
AAAGACTACATCCGCCACCTCCATGACAGCCAACACGTGGCTGTCTTCCACCGGGGCCGA
TTCTTCCGCATGGGGACCCACTCCCGAAACAGCCTGCTTTCCCCGAGAGCCCTGGAGCAG
CAGTTTCAGAGAATCCTGGATGATCCCTCACCGGCCTGCCCCCACGAGGAACATCTGGCA
GCTCTGACAGCTGCTCCCAGGGGCACGTGGGCCCAGGTGCGGACATCCCTGAAGACCCAG
GCAGCGGAGGCCCTGGAGGCGGTGGAAGGGGCCGCTTTCTTTGTGTCACTGGATGCTGAG
CCCGCGGGGCTCACCAGGGAGGACCCGGCAGCGTCGTTGGATGCCTACGCCCATGCTCTG
CTGGCCGGCCGGGGCCATGATCGCTGGTTTGACAAATCCTTCACCCTAATCGTCTTCTCT
AACGGGAAGCTGGGCCTCAGCGTGGAGCACTCCTGGGCCGACTGCCCCATCTCAGGACAC
ATGTGGGAGTTCACTCTGGCTACAGAATGCTTTCAGCTGGGCTACTCAACAGACGGCCAC
TGCAAGGGGCACCCGGACCCCACACTACCCCAGCCCCAGCGGCTGCAATGGGACCTTCCA
GACCAGATCCACTCCTCCATCTCTCTAGCCCTGAGGGGAGCCAAGATCTTGTCTGAAAAT
GTCGACTGCCATGTCGTTCCATTCTCCCTATTTGGCAAGAGCTTCATCCGACGCTGCCAC
CTCTCTTCAGACAGCTTCATCCAGATCGCCTTGCAACTGGCCCACTTCCGGGACAGGGGT
CAATTCTGCCTGACTTATGAGTCGGCCATGACTCGCTTATTCCTGGAAGGCCGGACGGAG
ACGGTGCGGTCTTGCACGAGGGAGGCCTGCAACTTTGTCAGGGCCATGGAGGACAAAGAG
AAGACGGACCCACAGTGCCTCGCCCTGTTCCGCGTGGCAGTGGACAAGCACCAGGCTCTG
CTGAAGGCAGCCATGAGCGGGCAGGGAGTTGACCGCCACCTGTTTGCGCTGTACATCGTG
TCCCGATTCCTCCACCTGCAGTCGCCCTTCCTGACCCAGGTCCATTCGGAGCAGTGGCAG
CTGTCCACCAGCCAGATCCCTGTTCAGCAAATGCATCTGTTTGACGTCCACAATTACCCG
GACTATGTTTCCTCAGGCGGTGGATTCGGGCCTGCTGATGACCATGGTTATGGTGTTTCT
TATATCTTCATGGGGGATGGCATGATCACCTTCCACATCTCCAGCAAAAAATCAAGCACA
AAAACGGATTCCCACAGGCTGGGGCAGCACATTGAGGACGCACTGCTGGATGTGGCCTCC
CTGTTCCAGGCGGGACAGCATTTTAAGCGCCGGTTCAGAGGGTCAGGGAAGGAGAACTCC
AGGCACAGGTGTGGATTTCTCTCCCGCCAGACTGGGGCCTCCAAGGCCTCAATGACATCC
ACCGACTTCTGA
Protein Properties
Number of Residues 803
Molecular Weight 89712.575
Theoretical pI 8.212
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carnitine O-palmitoyltransferase 1, brain isoform
MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPILSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALLLYRHRLNRQEIPPTLLMGMR
PLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSEN
VDCHVVPFSLFGKSFIRRCHLSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTE
TVRSCTREACNFVRAMEDKEKTDPQCLALFRVAVDKHQALLKAAMSGQGVDRHLFALYIV
SRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKENS
RHRCGFLSRQTGASKASMTSTDF
GenBank ID Protein 33340613
UniProtKB/Swiss-Prot ID Q8TCG5
UniProtKB/Swiss-Prot Entry Name CPT1C_HUMAN
PDB IDs Not Available
GenBank Gene ID AF357970
GeneCard ID CPT1C
GenAtlas ID CPT1C
HGNC ID HGNC:18540
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Price N, van der Leij F, Jackson V, Corstorphine C, Thomson R, Sorensen A, Zammit V: A novel brain-expressed protein related to carnitine palmitoyltransferase I. Genomics. 2002 Oct;80(4):433-42. [PubMed:12376098 ]