Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00327
Secondary Accession Numbers
  • 5563
Name 6-phosphogluconolactonase
Synonyms
  1. 6PGL
Gene Name PGLS
Protein Type Enzyme
Biological Properties
General Function Involved in 6-phosphogluconolactonase activity
Specific Function Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
Pathways
  • Glucose-6-phosphate dehydrogenase deficiency
  • Pentose Phosphate Pathway
  • Pentose phosphate pathway
  • Ribose-5-phosphate isomerase deficiency
  • Transaldolase deficiency
  • Warburg Effect
Reactions
6-phospho-D-glucono-1,5-lactone + Water → 6-Phosphogluconic acid details
6-Phosphonoglucono-D-lactone + Water → 6-Phosphogluconic acid details
GO Classification
Biological Process
pentose-phosphate shunt
pentose-phosphate shunt, oxidative branch
Cellular Component
cytosol
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
6-phosphogluconolactonase activity
carboxylesterase activity
Molecular Function
6-phosphogluconolactonase activity
monosaccharide binding
Process
metabolic process
primary metabolic process
pentose-phosphate shunt
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 19
Locus 19p13.2
SNPs PGLS
Gene Sequence
>777 bp
ATGGCCGCGCCGGCCCCGGGCCTCATCTCGGTGTTCTCGAGTTCCCAGGAGCTGGGTGCG
GCGCTAGCGCAGCTGGTGGCCCAGCGCGCAGCATGCTGCCTGGCAGGGGCCCGCGCCCGT
TTCGCGCTCGGCCTGTCGGGCGGGAGCCTCGTCTCGATGCTAGCCCGCGAGCTACCCGCC
GCCGTCGCCCCTGCCGGGCCAGCTAGCTTAGCGCGCTGGACGCTGGGCTTCTGCGACGAG
CGCCTCGTGCCCTTCGATCACGCCGAGAGCACGTACGGCCTCTACCGGACGCATCTTCTC
TCCAGACTGCCGATCCCAGAAAGCCAGGTGATCACCATTAACCCCGAGCTGCCTGTGGAG
GAGGCGGCTGAGGACTACGCCAAGAAGCTGAGACAGGCATTCCAAGGGGACTCCATCCCG
GTTTTCGACCTGCTGATCCTGGGGGTGGGCCCCGATGGTCACACCTGCTCACTCTTCCCA
GACCACCCCCTCCTACAGGAGCGGGAGAAGATTGTGGCTCCCATCAGTGACTCCCCGAAG
CCACCGCCACAGCGTGTGACCCTCACACTACCTGTCCTGAATGCAGCACGAACTGTCATC
TTTGTGGCAACTGGAGAAGGCAAGGCAGCTGTTCTGAAGCGCATTTTGGAGGACCAGGAG
GAAAACCCGCTGCCCGCCGCCCTGGTCCAGCCCCACACCGGGAAACTGTGCTGGTTCTTG
GACGAGGCGGCCGCCCGCCTCCTGACCGTGCCCTTCGAGAAGCATTCCACTTTGTAG
Protein Properties
Number of Residues 258
Molecular Weight 27546.495
Theoretical pI 6.048
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>6-phosphogluconolactonase
MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPA
AVAPAGPASLARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVE
EAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPK
PPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFL
DEAAARLLTVPFEKHSTL
GenBank ID Protein 6912586
UniProtKB/Swiss-Prot ID O95336
UniProtKB/Swiss-Prot Entry Name 6PGL_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_012088.2
GeneCard ID PGLS
GenAtlas ID PGLS
HGNC ID HGNC:8903
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Collard F, Collet JF, Gerin I, Veiga-da-Cunha M, Van Schaftingen E: Identification of the cDNA encoding human 6-phosphogluconolactonase, the enzyme catalyzing the second step of the pentose phosphate pathway(1). FEBS Lett. 1999 Oct 8;459(2):223-6. [PubMed:10518023 ]