Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00348
Secondary Accession Numbers
  • 5584
Name Carbohydrate sulfotransferase 1
Synonyms
  1. GST-1
  2. Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1
  3. KS6ST
  4. KSGal6ST
  5. KSST
  6. Keratan sulfate Gal-6 sulfotransferase
Gene Name CHST1
Protein Type Enzyme
Biological Properties
General Function Involved in sulfotransferase activity
Specific Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. Has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. May function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. Participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.
Pathways
  • Glycosaminoglycan biosynthesis - keratan sulfate
Reactions
Phosphoadenosine phosphosulfate + Keratan → Adenosine 3',5'-diphosphate + Keratan details
GO Classification
Biological Process
keratan sulfate biosynthetic process
galactose metabolic process
inflammatory response
polysaccharide metabolic process
Cellular Component
integral to membrane
Golgi membrane
Component
golgi membrane
membrane
cell part
organelle membrane
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfotransferase activity
Molecular Function
keratan sulfotransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 11
Locus 11p11.2
SNPs CHST1
Gene Sequence
>1236 bp
ATGCAATGTTCCTGGAAGGCCGTCCTCCTCCTTGCCCTGGCCTCCATTGCCATCCAGTAC
ACGGCCATCCGCACCTTCACCGCCAAGTCCTTTCACACCTGCCCCGGGCTGGCAGAGGCC
GGGCTGGCCGAGCGACTGTGCGAGGAGAGCCCCACCTTCGCCTACAACCTCTCCCGCAAG
ACCCACATCCTCATCCTGGCCACCACGCGCAGCGGCTCCTCCTTCGTGGGCCAGCTCTTC
AACCAGCACCTGGACGTCTTCTACCTGTTTGAGCCCCTCTACCACGTCCAGAACACGCTC
ATCCCCCGCTTCACCCAGGGCAAGAGCCCGGCCGACCGGCGGGTCATGCTAGGCGCCAGC
CGCGACCTCCTGCGGAGCCTCTACGACTGCGACCTCTACTTCCTGGAGAACTACATCAAG
CCGCCGCCGGTCAACCACACCACCGACAGGATCTTCCGCCGCGGGGCCAGCCGGGTCCTC
TGCTCCCGGCCTGTGTGCGACCCTCCGGGGCCAGCCGACCTGGTCCTGGAGGAGGGGGAC
TGTGTGCGCAAGTGCGGGCTACTCAACCTGACCGTGGCGGCCGAGGCGTGCCGCGAGCGC
AGCCACGTGGCCATCAAGACGGTGCGCGTGCCCGAGGTGAACGACCTGCGCGCCCTGGTG
GAAGACCCGCGATTAAACCTCAAGGTCATCCAGCTGGTCCGAGACCCCCGCGGCATTCTG
GCTTCGCGCAGCGAGACCTTCCGCGACACGTACCGGCTCTGGCGGCTCTGGTACGGCACC
GGGAGGAAACCCTACAACCTGGACGTGACGCAGCTGACCACGGTGTGCGAGGACTTCTCC
AACTCCGTGTCCACCGGCCTCATGCGGCCCCCGTGGCTCAAGGGCAAGTACATGTTGGTG
CGCTACGAGGACCTGGCTCGGAACCCTATGAAGAAGACCGAGGAGATCTACGGGTTCCTG
GGCATCCCGCTGGACAGCCACGTGGCCCGCTGGATCCAGAACAACACGCGGGGCGACCCC
ACCCTGGGCAAGCACAAATACGGCACCGTGCGAAACTCGGCGGCCACGGCCGAGAAGTGG
CGCTTCCGCCTCTCCTACGACATCGTGGCCTTTGCCCAGAACGCCTGCCAGCAGGTGCTG
GCCCAGCTGGGCTACAAGATCGCCGCCTCGGAGGAGGAGCTGAAGAACCCCTCGGTCAGC
CTGGTGGAGGAGCGGGACTTCCGCCCCTTCTCGTGA
Protein Properties
Number of Residues 411
Molecular Weight 46714.21
Theoretical pI 8.968
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carbohydrate sulfotransferase 1
MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLAEAGLAERLCEESPTFAYNLSRK
THILILATTRSGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGAS
RDLLRSLYDCDLYFLENYIKPPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGD
CVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGIL
ASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV
RYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTVRNSAATAEKW
RFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS
GenBank ID Protein 2887403
UniProtKB/Swiss-Prot ID O43916
UniProtKB/Swiss-Prot Entry Name CHST1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB003791
GeneCard ID CHST1
GenAtlas ID CHST1
HGNC ID HGNC:1969
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Fukuta M, Inazawa J, Torii T, Tsuzuki K, Shimada E, Habuchi O: Molecular cloning and characterization of human keratan sulfate Gal-6-sulfotransferase. J Biol Chem. 1997 Dec 19;272(51):32321-8. [PubMed:9405439 ]
  3. Mazany KD, Peng T, Watson CE, Tabas I, Williams KJ: Human chondroitin 6-sulfotransferase: cloning, gene structure, and chromosomal localization. Biochim Biophys Acta. 1998 Jul 1;1407(1):92-7. [PubMed:9639683 ]
  4. Li X, Tedder TF: CHST1 and CHST2 sulfotransferases expressed by human vascular endothelial cells: cDNA cloning, expression, and chromosomal localization. Genomics. 1999 Feb 1;55(3):345-7. [PubMed:10049591 ]
  5. Torii T, Fukuta M, Habuchi O: Sulfation of sialyl N-acetyllactosamine oligosaccharides and fetuin oligosaccharides by keratan sulfate Gal-6-sulfotransferase. Glycobiology. 2000 Feb;10(2):203-11. [PubMed:10642612 ]
  6. Bistrup A, Bhakta S, Lee JK, Belov YY, Gunn MD, Zuo FR, Huang CC, Kannagi R, Rosen SD, Hemmerich S: Sulfotransferases of two specificities function in the reconstitution of high endothelial cell ligands for L-selectin. J Cell Biol. 1999 May 17;145(4):899-910. [PubMed:10330415 ]
  7. Li X, Tu L, Murphy PG, Kadono T, Steeber DA, Tedder TF: CHST1 and CHST2 sulfotransferase expression by vascular endothelial cells regulates shear-resistant leukocyte rolling via L-selectin. J Leukoc Biol. 2001 Apr;69(4):565-74. [PubMed:11310842 ]