You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00407
Secondary Accession Numbers
  • 5644
Name Diphthine synthase
Synonyms
  1. Diphthamide biosynthesis methyltransferase
Gene Name DPH5
Protein Type Unknown
Biological Properties
General Function Involved in methyltransferase activity
Specific Function S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis (By similarity).
Pathways
  • peptidyl-diphthamide biosynthesis
Reactions
S-Adenosylmethionine + 2-(3-Carboxy-3-aminopropyl)-L-histidine → S-Adenosylhomocysteine + 2-(3-carboxy-3-(trimethylammonio)propyl)-L-histidine details
GO Classification
Biological Process
peptidyl-diphthamide biosynthetic process from peptidyl-histidine
Function
catalytic activity
transferase activity
s-adenosylmethionine-dependent methyltransferase activity
diphthine synthase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
diphthine synthase activity
Process
metabolic process
macromolecule metabolic process
peptidyl-histidine modification
peptidyl-diphthamide metabolic process
peptidyl-diphthamide biosynthetic process from peptidyl-histidine
macromolecule modification
protein modification process
peptidyl-amino acid modification
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p21.2
SNPs DPH5
Gene Sequence
>858 bp
ATGCTTTATCTCATCGGGTTGGGCCTGGGAGATGCCAAGGACATCACAGTCAAGGGCCTG
GAAGTTGTTAGACGCTGCAGTCGAGTGTATCTGGAAGCCTACACCTCAGTCCTAACTGTA
GGGAAGGAAGCCTTGGAAGAGTTTTATGGAAGAAAATTGGTTGTTGCTGATAGAGAAGAA
GTGGAACAAGAAGCAGATAATATTTTAAAGGATGCTGATATCAGTGATGTTGCATTCCTT
GTGGTTGGTGATCCATTTGGGGCCACAACACACAGTGATCTTGTTCTAAGAGCAACAAAG
CTGGGAATTCCTTATAGAGTTATTCACAATGCCTCCATAATGAATGCTGTAGGCTGCTGT
GGTTTACAGTTATATAAGTTTGGAGAGACAGTTTCTATTGTTTTTTGGACAGACACTTGG
AGACCAGAAAGCTTCTTTGACAAAGTGAAGAAGAACAGACAAAATGGCATGCACACATTA
TGTTTACTAGACATCAAAGTAAAGGAGCAGTCTTTGGAAAATCTAATCAAGGGAAGGAAG
ATCTATGAACCTCCACGGTATATGAGTGTAAACCAAGCAGCCCAGCAGCTTCTGGAGATT
GTTCAAAATCAAAGAATACGAGGAGAAGAACCAGCAGTTACCGAGGAGACACTTTGTGTT
GGCTTAGCCAGGGTTGGAGCCGACGACCAGAAAATTGCAGCAGGCACTTTAAGGCAAATG
TGCACTGTGGACTTGGGAGAACCATTGCATTCCTTGATCATCACAGGAGGCAGCATACAT
CCAATGGAGATGGAGATGCTAAGTCTGTTTTCCATACCAGAAAATAGCTCAGAATCTCAA
AGCATCAATGGACTTTGA
Protein Properties
Number of Residues 285
Molecular Weight 31651.17
Theoretical pI 5.307
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Diphthine synthase
MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREE
VEQEADNILKDADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCC
GLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRK
IYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQM
CTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSINGL
GenBank ID Protein 117190326
UniProtKB/Swiss-Prot ID Q9H2P9
UniProtKB/Swiss-Prot Entry Name DPH5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001077394.1
GeneCard ID DPH5
GenAtlas ID DPH5
HGNC ID HGNC:24270
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  4. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 2000 May;10(5):703-13. [PubMed:10810093 ]