You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00457
Secondary Accession Numbers
  • 5695
Name Ribonuclease pancreatic
Synonyms
  1. HP-RNase
  2. RIB-1
  3. RNase 1
  4. RNase A
  5. RNase UpI-1
  6. Ribonuclease 1
  7. Ribonuclease A
Gene Name RNASE1
Protein Type Enzyme
Biological Properties
General Function Involved in nucleic acid binding
Specific Function Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single stranded and double stranded RNA
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
nucleic acid binding
nuclease activity
endonuclease activity
endoribonuclease activity
endoribonuclease activity, producing 3'-phosphomonoesters
pancreatic ribonuclease activity
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 14q11.2
SNPs RNASE1
Gene Sequence
>471 bp
ATGGCTCTGGAGAAGTCTCTTGTCCGGCTCCTTCTGCTTGTCCTGATACTGCTGGTGCTG
GGCTGGGTCCAGCCTTCCCTGGGCAAGGAATCCCGGGCCAAGAAATTCCAGCGGCAGCAT
ATGGACTCAGACAGTTCCCCCAGCAGCAGCTCCACCTACTGTAACCAAATGATGAGGCGC
CGGAATATGACACAGGGGCGGTGCAAACCAGTGAACACCTTTGTGCACGAGCCCCTGGTA
GATGTCCAGAATGTCTGTTTCCAGGAAAAGGTCACCTGCAAGAACGGGCAGGGCAACTGC
TACAAGAGCAACTCCAGCATGCACATCACAGACTGCCGCCTGACAAACGGCTCCAGGTAC
CCCAACTGTGCATACCGGACCAGCCCGAAGGAGAGACACATCATTGTGGCCTGTGAAGGG
AGCCCATATGTGCCAGTCCACTTTGATGCTTCTGTGGAGGACTCTACCTAA
Protein Properties
Number of Residues 156
Molecular Weight 17644.1
Theoretical pI 8.94
Pfam Domain Function
Signals
  • 1-28
Transmembrane Regions
  • None
Protein Sequence
>Ribonuclease pancreatic
MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P07998
UniProtKB/Swiss-Prot Entry Name RNAS1_HUMAN
PDB IDs
GenBank Gene ID D26129
GeneCard ID RNASE1
GenAtlas ID RNASE1
HGNC ID HGNC:10044
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sakakibara R, Hashida K, Kitahara T, Ishiguro M: Characterization of a unique nonsecretory ribonuclease from urine of pregnant women. J Biochem. 1992 Mar;111(3):325-30. [PubMed:1587793 ]
  4. Seno M, Futami J, Kosaka M, Seno S, Yamada H: Nucleotide sequence encoding human pancreatic ribonuclease. Biochim Biophys Acta. 1994 Aug 2;1218(3):466-8. [PubMed:8049276 ]
  5. Schienman JE, Holt RA, Auerbach MR, Stewart CB: Duplication and divergence of 2 distinct pancreatic ribonuclease genes in leaf-eating African and Asian colobine monkeys. Mol Biol Evol. 2006 Aug;23(8):1465-79. Epub 2006 Jun 2. [PubMed:16751256 ]
  6. Kochetov AV, Lukasheva VV, Filipenko ML, Mertvetsov NP, Rivkin MI: [Primary structure of the coding part of the gene for human pancreatic ribonuclease and its chromosomal location]. Bioorg Khim. 1995 Sep;21(9):691-4. [PubMed:8588814 ]
  7. Russo N, de Nigris M, Ciardiello A, Di Donato A, D'Alessio G: Expression in mammalian cells, purification and characterization of recombinant human pancreatic ribonuclease. FEBS Lett. 1995 Aug 7;369(2-3):352. [PubMed:7649283 ]
  8. Haugg M, Schein CH: The DNA sequences of the human and hamster secretory ribonucleases determined with the polymerase chain reaction (PCR). Nucleic Acids Res. 1992 Feb 11;20(3):612. [PubMed:1741299 ]
  9. Beintema JJ, Wietzes P, Weickmann JL, Glitz DG: The amino acid sequence of human pancreatic ribonuclease. Anal Biochem. 1984 Jan;136(1):48-64. [PubMed:6201087 ]
  10. Beintema JJ, Blank A, Schieven GL, Dekker CA, Sorrentino S, Libonati M: Differences in glycosylation pattern of human secretory ribonucleases. Biochem J. 1988 Oct 15;255(2):501-5. [PubMed:3202829 ]
  11. Mizuta K, Awazu S, Yasuda T, Kishi K: Purification and characterization of three ribonucleases from human kidney: comparison with urine ribonucleases. Arch Biochem Biophys. 1990 Aug 15;281(1):144-51. [PubMed:2383019 ]
  12. Sakakibara R, Hashida K, Tominaga N, Sakai K, Ishiguro M, Imamura S, Ohmatsu F, Sato E: A putative mouse oocyte maturation inhibitory protein from urine of pregnant women: N-terminal sequence homology with human nonsecretory ribonuclease. Chem Pharm Bull (Tokyo). 1991 Jan;39(1):146-9. [PubMed:2049798 ]
  13. Yasuda T, Nadano D, Takeshita H, Kishi K: Two distinct secretory ribonucleases from human cerebrum: purification, characterization and relationships to other ribonucleases. Biochem J. 1993 Dec 15;296 ( Pt 3):617-25. [PubMed:8280059 ]
  14. Pous J, Canals A, Terzyan SS, Guasch A, Benito A, Ribo M, Vilanova M, Coll M: Three-dimensional structure of a human pancreatic ribonuclease variant, a step forward in the design of cytotoxic ribonucleases. J Mol Biol. 2000 Oct 13;303(1):49-60. [PubMed:11021969 ]
  15. Pous J, Mallorqui-Fernandez G, Peracaula R, Terzyan SS, Futami J, Tada H, Yamada H, Seno M, de Llorens R, Gomis-Ruth FX, Coll M: Three-dimensional structure of human RNase 1 delta N7 at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 Apr;57(Pt 4):498-505. [PubMed:11264578 ]