Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00466
Secondary Accession Numbers
  • 5706
Name Galactoside 2-alpha-L-fucosyltransferase 2
Synonyms
  1. Alpha(1,2)FT 2
  2. Fucosyltransferase 2
  3. GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
  4. SE2
  5. Se
  6. Secretor blood group alpha-2-fucosyltransferase
  7. Secretor factor
Gene Name FUT2
Protein Type Enzyme
Biological Properties
General Function Involved in galactoside 2-alpha-L-fucosyltransferase activity
Specific Function Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values.
Pathways
  • Glycosphingolipid biosynthesis - globo series
  • Glycosphingolipid biosynthesis - lacto and neolacto series
  • protein glycosylation
Reactions
GDP-L-fucose + beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide → Guanosine diphosphate + alpha-L-fucosyl-(1->2)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide details
GDP-L-fucose + Galactosylgloboside → GDP + Globo-H details
GDP-L-fucose + Paragloboside → GDP + IV2Fuc-nLc4Cer details
GDP-L-fucose + nLc5Cer → GDP + Type II B antigen details
GDP-L-fucose + → GDP + Type IIIH glycolipid details
GDP-L-fucose + nLc6Cer → GDP + VI2Fuc-nLc6 details
GDP-L-fucose + → GDP + details
GDP-L-fucose + iso-nLc8Cer → GDP + Monofucosyllactoisooctaosylceramide details
GDP-L-fucose + Monofucosyllactoisooctaosylceramide → GDP + details
GDP-L-fucose + Lc4Cer → GDP + IV2Fuc-Lc4Cer details
GDP-L-fucose + → GDP + Type IB glycolipid details
GO Classification
Biological Process
L-fucose catabolic process
protein glycosylation
Cellular Component
Golgi cisterna membrane
integral to Golgi membrane
Component
membrane
golgi apparatus
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
fucosyltransferase activity
alpha(1,2)-fucosyltransferase activity
galactoside 2-alpha-l-fucosyltransferase activity
Molecular Function
galactoside 2-alpha-L-fucosyltransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Single-pass type II membrane protein
  2. Golgi apparatus
  3. Golgi stack membrane
Gene Properties
Chromosome Location 19
Locus 19q13.3
SNPs FUT2
Gene Sequence
>1032 bp
ATGCTGGTCGTTCAGATGCCTTTCTCCTTTCCCATGGCCCACTTCATCCTCTTTGTCTTT
ACGGTTTCCACTATATTTCACGTTCAGCAGCGGCTAGCGAAGATTCAAGCCATGTGGGAG
TTACCGGTGCAGATACCAGTGCTAGCCTCAACATCAAAGGCACTGGGACCCAGCCAGCTC
AGGGGGATGTGGACGATCAATGCAATAGGCCGCCTGGGGAACCAGATGGGCGAGTACGCC
ACACTGTACGCCCTGGCCAAGATGAACGGGCGGCCCGCCTTCATCCCGGCCCAGATGCAC
AGCACCCTGGCCCCCATCTTCAGAATCACCCTGCCGGTGCTGCACAGCGCCACGGCCAGC
AGGATCCCCTGGCAGAACTACCACCTGAACGACTGGATGGAGGAGGAATACCGCCACATC
CCGGGGGAGTACGTCCGCTTCACCGGCTACCCCTGCTCCTGGACCTTCTACCACCACCTC
CGCCAGGAGATCCTCCAGGAGTTCACCCTGCACGACCACGTGCGGGAGGAGGCCCAGAAG
TTCCTGCGGGGCCTGCAGGTGAACGGGAGCCGGCCGGGCACCTTTGTAGGGGTCCATGTT
CGCCGAGGGGACTATGTCCATGTCATGCCAAAAGTGTGGAAGGGGGTGGTGGCCGACCGG
CGATACCTACAGCAGGCCCTGGACTGGTTCCGAGCTCGCTACAGCTCCCTCATCTTCGTG
GTCACCAGTAATGGCATGGCCTGGTGTCGGGAGAACATTGACACCTCCCACAGTGATGTG
GTGTTTGCTGGCGATGGCATTGAGGGCTCACCTGCCAAAGATTTTGCTCTACTCACACAG
TGTAACCACACCATCATGACCATTGGGACGTTCGGGATCTGGGCCGCATACCTCACGGGC
GGAGACACCATCTACCTGGCCAATTACACCCTCCCCGACTCCCCTTTCCTCAAAATCTTT
AAGCCAGAGGCAGCCTTCCTGCCGGAGTGGACAGGGATTGCCGCAGACCTGTCCCCCTTA
CTCAAGCACTAA
Protein Properties
Number of Residues 343
Molecular Weight 39016.84
Theoretical pI 8.544
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Galactoside 2-alpha-L-fucosyltransferase 2
MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQL
RGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATAS
RIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQK
FLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFV
VTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTG
GDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
GenBank ID Protein 60115832
UniProtKB/Swiss-Prot ID Q10981
UniProtKB/Swiss-Prot Entry Name FUT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AY937240
GeneCard ID FUT2
GenAtlas ID FUT2
HGNC ID HGNC:4013
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Kelly RJ, Rouquier S, Giorgi D, Lennon GG, Lowe JB: Sequence and expression of a candidate for the human Secretor blood group alpha(1,2)fucosyltransferase gene (FUT2). Homozygosity for an enzyme-inactivating nonsense mutation commonly correlates with the non-secretor phenotype. J Biol Chem. 1995 Mar 3;270(9):4640-9. [PubMed:7876235 ]
  3. Kudo T, Iwasaki H, Nishihara S, Shinya N, Ando T, Narimatsu I, Narimatsu H: Molecular genetic analysis of the human Lewis histo-blood group system. II. Secretor gene inactivation by a novel single missense mutation A385T in Japanese nonsecretor individuals. J Biol Chem. 1996 Apr 19;271(16):9830-7. [PubMed:8621666 ]
  4. Koda Y, Soejima M, Wang B, Kimura H: Structure and expression of the gene encoding secretor-type galactoside 2-alpha-L-fucosyltransferase (FUT2). Eur J Biochem. 1997 Jun 15;246(3):750-5. [PubMed:9219535 ]
  5. Koda Y, Soejima M, Liu Y, Kimura H: Molecular basis for secretor type alpha(1,2)-fucosyltransferase gene deficiency in a Japanese population: a fusion gene generated by unequal crossover responsible for the enzyme deficiency. Am J Hum Genet. 1996 Aug;59(2):343-50. [PubMed:8755920 ]
  6. Liu Y, Koda Y, Soejima M, Pang H, Schlaphoff T, du Toit ED, Kimura H: Extensive polymorphism of the FUT2 gene in an African (Xhosa) population of South Africa. Hum Genet. 1998 Aug;103(2):204-10. [PubMed:9760207 ]
  7. Hazra A, Kraft P, Selhub J, Giovannucci EL, Thomas G, Hoover RN, Chanock SJ, Hunter DJ: Common variants of FUT2 are associated with plasma vitamin B12 levels. Nat Genet. 2008 Oct;40(10):1160-2. doi: 10.1038/ng.210. Epub 2008 Sep 7. [PubMed:18776911 ]