You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00492
Secondary Accession Numbers
  • 5739
Name Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
Synonyms
  1. D-xylose 1-dehydrogenase
  2. D-xylose-NADP dehydrogenase
  3. Dimeric dihydrodiol dehydrogenase
  4. Hum2DD
Gene Name DHDH
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways
  • Metabolism of xenobiotics by cytochrome P450
  • Pentose and glucuronate interconversions
Reactions
trans-1,2-Dihydrobenzene-1,2-diol + NADP → Pyrocatechol + NADPH details
D-Xylose + NADP → D-Xylono-1,5-lactone + NADPH details
D-Xylose + NADP → D-Xylono-1,5-lactone + NADPH + Hydrogen Ion details
1,2-Dihydronaphthalene-1,2-diol + NADP → Naphthalene-1,2-diol + NADPH + Hydrogen Ion details
GO Classification
Biological Process
D-xylose catabolic process
carbohydrate metabolic process
Function
binding
catalytic activity
oxidoreductase activity
Molecular Function
electron carrier activity
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity
D-xylose 1-dehydrogenase (NADP+) activity
NAD(P)+ transhydrogenase activity
nucleotide binding
Process
metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q13.3
SNPs DHDH
Gene Sequence
>1005 bp
ATGGCGCTGCGCTGGGGCATCGTGTCTGTCGGCCTCATCTCCAGCGACTTCACAGCCGTG
CTGCAGACGCTGCCTCGCTCTGAGCACCAGGTGGTGGCGGTGGCGGCCCGCGATCTGAGC
CGTGCGAAGGAGTTTGCACAGAAACACGACATCCCCAAGGCCTACGGCTCCTATGAGGAG
CTGGCCAAGGACCCGAGCGTGGAGGTGGCCTACATTGGCACCCAGCACCCCCAGCACAAG
GCGGCGGTGATGCTGTGCTTGGCGGCGGGCAAGGCCGTTCTGTGCGAGAAGCCCACGGGC
GTGAACGCGGCGGAAGTTCGCGAGATGGTCGCGGAGGCCCGATCCCGAGCCCTCTTCCTT
ATGGAGGCCATCTGGACCCGCTTCTTTCCTGCCTCCGAGGCTCTGAGGTCTGTTTTGGCC
CAGGGAACTCTAGGAGACCTCCGGGTGGCTCGGGCAGAATTTGGGAAGAATCTCATCCAC
GTTCCCCGGGCCGTAGACCGGGCCCAGGCTGGGGGGGCCCTGCTGGACATCGGCATCTAC
TGTGTCCAGTTCACCTCCATGGTCTTTGGAGGGCAGAAGCCAGAGAAGATTTCTGTCGTG
GGAAGGCGTCATGAAACAGGTGTGGATGACACTGTCACGGTGCTCCTGCAGTACCCAGGG
GAGGTCCATGGCAGCTTCACCTGCAGCATCACCGTGCAGCTCTCCAACACGGCCTCCGTG
AGCGGCACCAAGGGCATGGTACAGCTCCTCAACCCCTGCTGGTGCCCGACCGAGCTGGTG
GTGAAGGGGGAGCATAAGGAGTTCCCGCTGCCCCCAGTCCCAAAGGACTGCAATTTTGAC
AACGGGGCAGGCATGAGTTATGAGGCCAAGCACGTCTGGGAGTGCCTACGCAAGGGTATG
AAGGAAAGTCCTGTGATTCCCCTGTCGGAAAGTGAGCTCCTGGCTGACATCCTTGAAGAG
GTGAGGAAGGCCATTGGAGTCACCTTCCCCCAAGACAAACGCTGA
Protein Properties
Number of Residues 334
Molecular Weight 36381.705
Theoretical pI 7.2
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEE
LAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFL
MEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIY
CVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASV
SGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGM
KESPVIPLSESELLADILEEVRKAIGVTFPQDKR
GenBank ID Protein 5771250
UniProtKB/Swiss-Prot ID Q9UQ10
UniProtKB/Swiss-Prot Entry Name DHDH_HUMAN
PDB IDs Not Available
GenBank Gene ID AB021933
GeneCard ID DHDH
GenAtlas ID DHDH
HGNC ID HGNC:17887
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Arimitsu E, Aoki S, Ishikura S, Nakanishi K, Matsuura K, Hara A: Cloning and sequencing of the cDNA species for mammalian dimeric dihydrodiol dehydrogenases. Biochem J. 1999 Sep 15;342 Pt 3:721-8. [PubMed:10477285 ]