Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00496
Secondary Accession Numbers
  • 5743
Name tRNA-dihydrouridine synthase 2-like
Synonyms
  1. URLC8
  2. Up-regulated in lung cancer protein 8
  3. hDUS2
Gene Name DUS2L
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Dihydrouridine synthase. Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
oxidoreductase activity, acting on the ch-ch group of donors
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
nucleic acid binding
oxidoreductase activity
fad or fadh2 binding
rna binding
trna dihydrouridine synthase activity
double-stranded rna binding
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna processing
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
oxidation reduction
Cellular Location
  1. Cytoplasm
  2. Endoplasmic reticulum
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs DUS2L
Gene Sequence
>1482 bp
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTT
CGGGTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTAC
TGTGAGGAGCTGATCGACCTCAAGATGATTCAGTGCAAGAGAGTTGTTAATGAGGTGCTC
AGCACAGTGGACTTTGTCGCCCCTGATGATCGAGTTGTCTTCCGCACCTGTGAAAGAGAG
CAGAACAGGGTGGTCTTCCAGATGGGGACTTCAGACGCAGAGCGAGCCCTTGCTGTGGCC
AGGCTTGTAGAAAATGATGTGGCTGGTATTGATGTCAACATGGGCTGTCCAAAACAATAT
TCCACCAAGGGAGGAATGGGAGCTGCCCTGCTGTCAGACCCTGACAAGATTGAGAAGATC
CTCAGCACTCTTGTTAAAGGGACACGCAGACCTGTGACCTGCAAGATTCGCATCCTGCCA
TCGCTAGAAGATACCCTGAGCCTTGTGAAGCGGATAGAGAGGACTGGCATTGCTGCCATC
GCAGTTCATGGGAGGAAGCGGGAGGAGCGACCTCAGCATCCTGTCAGCTGTGAAGTCATC
AAAGCCATTGCTGATACCCTCTCCATTCCTGTCATAGCCAACGGAGGATCTCATGACCAC
ATCCAACAGTATTCGGACATAGAGGACTTTCGACAAGCCACGGCAGCCTCTTCCGTGATG
GTGGCCCGAGCAGCCATGTGGAACCCATCTATCTTCCTCAAGGAGGGTCTGCGGCCCCTG
GAGGAGGTCATGCAGAAATACATCAGATACGCGGTGCAGTATGACAACCACTACACCAAC
ACCAAGTACTGCTTGTGCCAGATGCTACGAGAACAGCTGGAGTCGCCCCAGGGAAGGTTG
CTCCATGCTGCCCAGTCTTCCCGGGAAATTTGTGAGGCCTTTGGCCTTGGTGCCTTCTAT
GAGGAGACCACACAGGAGCTGGATGCCCAGCAGGCCAGGCTCTCAGCCAAGACTTCAGAG
CAGACAGGGGAGCCAGCTGAAGATACCTCTGGTGTCATTAAGATGGCTGTCAAGTTTGAC
CGGAGAGCATACCCAGCCCAGATCACCCCTAAGATGTGCCTACTAGAGTGGTGCCGGAGG
GAGAAGTTGGCACAGCCTGTGTATGAAACGGTTCAACGCCCTCTAGATCGCCTGTTCTCC
TCTATTGTCACCGTTGCTGAACAAAAGTATCAGTCTACCTTGTGGGACAAGTCCAAGAAA
CTGGCGGAGCAGGCTGCAGCCATCGTCTGTCTGCGGAGCCAGGGCCTCCCTGAGGGTCGG
CTGGGTGAGGAGAGCCCTTCCTTGCACAAGCGAAAGAGGGAGGCTCCTGACCAAGACCCT
GGGGGCCCCAGAGCTCAGGAGCTAGCACAACCTGGGGATCTGTGCAAGAAGCCCTTTGTG
GCCTTGGGAAGTGGTGAAGAAAGCCCCCTGGAAGGCTGGTGA
Protein Properties
Number of Residues 493
Molecular Weight 55049.8
Theoretical pI 7.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>tRNA-dihydrouridine synthase 2-like
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVL
STVDFVAPDDRVVFRTCEREQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQY
STKGGMGAALLSDPDKIEKILSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAI
AVHGRKREERPQHPVSCEVIKAIADTLSIPVIANGGSHDHIQQYSDIEDFRQATAASSVM
VARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRL
LHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTSGVIKMAVKFD
RRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKK
LAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFV
ALGSGEESPLEGW
GenBank ID Protein 71006842
UniProtKB/Swiss-Prot ID Q9NX74
UniProtKB/Swiss-Prot Entry Name DUS2L_HUMAN
PDB IDs Not Available
GenBank Gene ID AB101210
GeneCard ID DUS2L
GenAtlas ID DUS2L
HGNC ID HGNC:26014
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Kato T, Daigo Y, Hayama S, Ishikawa N, Yamabuki T, Ito T, Miyamoto M, Kondo S, Nakamura Y: A novel human tRNA-dihydrouridine synthase involved in pulmonary carcinogenesis. Cancer Res. 2005 Jul 1;65(13):5638-46. [PubMed:15994936 ]