You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00501
Secondary Accession Numbers
  • 5748
  • HMDBP05050
Name S-formylglutathione hydrolase
Synonyms
  1. Esterase D
  2. FGH
  3. Methylumbelliferyl-acetate deacetylase
Gene Name ESD
Protein Type Enzyme
Biological Properties
General Function Involved in carboxylesterase activity
Specific Function Serine hydrolase involved in the detoxification of formaldehyde.
Pathways Not Available
Reactions
S-Formylglutathione + Water → Glutathione + Formic acid details
4-Methylumbelliferyl acetate + Water → 4-Methylumbelliferone + Acetic acid details
GO Classification
Biological Process
formaldehyde catabolic process
Cellular Component
Golgi apparatus
nucleus
cytoplasmic membrane-bounded vesicle
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
organelle
vesicle
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
carboxylesterase activity
thiolester hydrolase activity
s-formylglutathione hydrolase activity
Molecular Function
carboxylesterase activity
methylumbelliferyl-acetate deacetylase activity
S-formylglutathione hydrolase activity
Cellular Location
  1. Cytoplasm
  2. Cytoplasmic vesicle
Gene Properties
Chromosome Location 13
Locus 13q14.1-q14.2
SNPs ESD
Gene Sequence
>849 bp
ATGGCATTGAAGCAGATTTCCAGCAACAAGTGCTTTGGGGGATTGCAGAAAGTTTTTGAA
CATGACAGTGTTGAACTAAACTGCAAAATGAAATTTGCTGTCTACTTACCACCAAAGGCA
GAAACAGGAAAGTGCCCTGCACTGTATTGGCTCTCAGGTTTAACTTGCACAGAGCAAAAT
TTTATATCAAAATCTGGTTATCATCAGTCTGCTTCAGAACATGGTCTTGTTGTCATTGCT
CCAGATACCAGCCCTCGTGGCTGCAATATTAAAGGTGAAGATGAGAGCTGGGACTTTGGC
ACTGGTGCTGGATTTTATGTTGATGCCACTGAAGATCCTTGGAAAACCAACTACAGAATG
TACTCTTATGTCACAGAGGAGCTTCCCCAACTCATAAATGCCAATTTTCCAGTGGATCCC
CAAAGGATGTCTATTTTTGGCCACTCCATGGGAGGTCATGGAGCTCTGATCTGTGCTTTG
AAAAATCCTGGAAAATACAAATCTGTGTCAGCATTTGCTCCAATTTGCAACCCTGTACTC
TGTCCCTGGGGCAAAAAAGCCTTTAGTGGATATTTGGGAACAGATCAAAGTAAATGGAAG
GCTTATGATGCTACCCACCTTGTGAAATCCTATCCAGGATCTCAGCTGGACATACTAATT
GATCAAGGGAAAGATGACCAGTTTCTTTTAGATGGACAGTTACTCCCTGATAACTTCATA
GCTGCCTGTACAGAAAAGAAAATCCCCGTTGTTTTTCGATTGCAAGAGGGTTATGATCAT
AGCTACTACTTCATTGCAACCTTTATTACTGACCACATCAGACATCATGCTAAATACCTG
AATGCATGA
Protein Properties
Number of Residues 282
Molecular Weight 31462.545
Theoretical pI 7.014
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>S-formylglutathione hydrolase
MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQN
FISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRM
YSYVTEELPQLINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVL
CPWGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFI
AACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLNA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P10768
UniProtKB/Swiss-Prot Entry Name ESTD_HUMAN
PDB IDs
GenBank Gene ID AF112219
GeneCard ID ESD
GenAtlas ID ESD
HGNC ID HGNC:3465
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  5. Saito S, Iida A, Sekine A, Kawauchi S, Higuchi S, Ogawa C, Nakamura Y: Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population. J Hum Genet. 2003;48(5):249-70. Epub 2003 Apr 29. [PubMed:12721789 ]
  6. Lee EY, Lee WH: Molecular cloning of the human esterase D gene, a genetic marker of retinoblastoma. Proc Natl Acad Sci U S A. 1986 Sep;83(17):6337-41. [PubMed:3462698 ]
  7. Young LJ, Lee EY, To HA, Bookstein R, Shew JY, Donoso LA, Sery T, Giblin M, Shields JA, Lee WH: Human esterase D gene: complete cDNA sequence, genomic structure, and application in the genetic diagnosis of human retinoblastoma. Hum Genet. 1988 Jun;79(2):137-41. [PubMed:3164702 ]
  8. Squire J, Dryja TP, Dunn J, Goddard A, Hofmann T, Musarella M, Willard HF, Becker AJ, Gallie BL, Phillips RA: Cloning of the esterase D gene: a polymorphic gene probe closely linked to the retinoblastoma locus on chromosome 13. Proc Natl Acad Sci U S A. 1986 Sep;83(17):6573-7. [PubMed:3462714 ]
  9. Eiberg H, Mohr J: Identity of the polymorphisms for esterase D and S-formylglutathione hydrolase in red blood cells. Hum Genet. 1986 Oct;74(2):174-5. [PubMed:3770744 ]
  10. Wu D, Li Y, Song G, Zhang D, Shaw N, Liu ZJ: Crystal structure of human esterase D: a potential genetic marker of retinoblastoma. FASEB J. 2009 May;23(5):1441-6. doi: 10.1096/fj.08-125286. Epub 2009 Jan 6. [PubMed:19126594 ]
  11. Tsuchida S, Fukui E, Ikemoto S: Molecular analysis of esterase D polymorphism. Hum Genet. 1994 Mar;93(3):255-8. [PubMed:7907313 ]