You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00521
Secondary Accession Numbers
  • 5769
Name Mitochondrial peptide methionine sulfoxide reductase
Synonyms
  1. PMSR
  2. Peptide Met(O) reductase
  3. Peptide-methionine (S)-S-oxide reductase
  4. Protein-methionine-S-oxide reductase
Gene Name MSRA
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
Specific Function Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Pathways Not Available
Reactions
Peptide-L-methionine + thioredoxin disulfide + Water → peptide-L-methionine (S)-S-oxide + thioredoxin details
L-Methionine + thioredoxin disulfide + Water → Methionine sulfoxide + thioredoxin details
GO Classification
Biological Process
response to oxidative stress
cellular protein modification process
aging
methionine metabolic process
Cellular Component
mitochondrion
nucleus
membrane
Function
oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
catalytic activity
oxidoreductase activity, acting on a sulfur group of donors
oxidoreductase activity
Molecular Function
peptide-methionine (S)-S-oxide reductase activity
Process
metabolic process
macromolecule metabolic process
oxidation reduction
protein metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8p23.1
SNPs MSRA
Gene Sequence
>708 bp
ATGCTCTCGGCCACCCGGAGGGCTTGCCAGCTCCTCCTCCTCCACAGCCTCTTTCCCGTC
CCGAGGATGGGCAACTCGGCCTCGAACATCGTCAGCCCCCAGGAGGCCTTGCCGGGCCGG
AAGGAACAGACCCCTGTAGCGGCCAAACATCATGTCAATGGCAACAGAACAGTCGAACCT
TTCCCAGAGGGAACACAGATGGCTGTATTTGGAATGGGATGTTTCTGGGGAGCTGAAAGG
AAATTCTGGGTCTTGAAAGGAGTGTATTCAACTCAAGTTGGTTTTGCAGGAGGCTATACT
TCAAATCCTACTTATAAAGAAGTCTGCTCAGAAAAAACTGGCCATGCAGAAGTCGTCCGA
GTGGTGTACCAGCCAGAACACATGAGTTTTGAGGAACTGCTCAAGGTCTTCTGGGAGAAT
CACGACCCGACCCAAGGTATGCGCCAGGGGAACGACCATGGCACTCAGTACCGCTCGGCC
ATCTACCCGACCTCTGCCAAGCAAATGGAGGCAGCCCTGAGCTCCAAAGAGAACTACCAA
AAGGTTCTTTCAGAGCACGGCTTCGGCCCCATCACTACCGACATCCGGGAGGGACAGACT
TTCTACTATGCGGAAGACTACCACCAGCAGTACCTGAGCAAGAACCCCAATGGCTACTGC
GGCCTTGGGGGCACCGGCGTGTCCTGCCCAGTGGGTATTAAAAAATAA
Protein Properties
Number of Residues 235
Molecular Weight 21737.41
Theoretical pI 7.592
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Peptide methionine sulfoxide reductase
MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEP
FPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVR
VVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQ
KVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
GenBank ID Protein 6136945
UniProtKB/Swiss-Prot ID Q9UJ68
UniProtKB/Swiss-Prot Entry Name MSRA_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ242973
GeneCard ID MSRA
GenAtlas ID MSRA
HGNC ID HGNC:7377
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Kuschel L, Hansel A, Schonherr R, Weissbach H, Brot N, Hoshi T, Heinemann SH: Molecular cloning and functional expression of a human peptide methionine sulfoxide reductase (hMsrA). FEBS Lett. 1999 Jul 30;456(1):17-21. [PubMed:10452521 ]