You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00527
Secondary Accession Numbers
  • 5776
Name Phospholipase DDHD1
Synonyms
  1. DDHD domain-containing protein 1
  2. PA-PLA1
  3. Phosphatidic acid-preferring phospholipase A1 homolog
Gene Name DDHD1
Protein Type Enzyme
Biological Properties
General Function Involved in metal ion binding
Specific Function Probable phospholipase that hydrolyzes phosphatidic acid. The different isoforms may change the substrate specificity
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 14q21
SNPs DDHD1
Gene Sequence
>2703 bp
ATGAATTACCCGGGCCGCGGGTCCCCACGGAGCCCCGAGCATAACGGCCGAGGCGGCGGC
GGCGGCGCCTGGGAGCTGGGCTCAGACGCGAGGCCAGCGTTCGGCGGCGGCGTCTGCTGC
TTCGAGCACCTGCCCGGCGGGGACCCGGACGACGGCGACGTGCCCCTGGCCCTGCTGCGC
GGGGAACCCGGGCTGCATTTGGCGCCGGGCACCGACGACCACAACCACCACCTCGCGCTG
GACCCCTGCCTCAGTGACGAGAACTATGACTTCAGCTCCGCCGAGTCGGGCTCCTCGCTG
CGCTACTACAGCGAGGGTGAGAGCGGCGGCGGCGGCAGCTCCTTGTCGCTGCACCCGCCG
CAGCAGCCTCCGCTGGTCCCGACGAACTCGGGGGGCGGCGGCGCGACAGGAGGGTCCCCC
GGGGAAAGGAAACGTACCCGGCTTGGCGGCCCGGCGGCCCGGCACCGCTATGAGGTAGTG
ACGGAGCTGGGCCCGGAGGAGGTACGCTGGTTCTACAAGGAGGACAAGAAGACCTGGAAG
CCCTTCATCGGCTACGACTCGCTCCGCATCGAGCTCGCCTTCCGGACCCTGCTGCAGACC
ACGGGTGCCCGGCCCCAGGGCGGGGACCGGGACGGCGACCATGTGTGCTCCCCCACGGGC
CCAGCCTCCAGTTCCGGAGAAGATGACGATGAGGACCGCGCCTGCGGCTTCTGCCAGAGT
ACGACGGGGCACGAGCCGGAGATGGTGGAGCTTGTGAACATCGAGCCTGTGTGCGTGCGG
GGCGGCCTCTACGAGGTGGATGTGACCCAAGGAGAGTGCTACCCGGTGTACTGGAACCAG
GCTGATAAAATACCAGTAATGCGTGGACAGTGGTTTATTGACGGCACTTGGCAGCCTCTA
GAAGAGGAAGAAAGTAATTTAATTGAGCAAGAACATCTCAATTGTTTTAGGGGCCAGCAG
ATGCAGGAAAATTTCGATATTGAAGTGTCAAAATCCATAGATGGAAAAGATGCTGTTCAT
AGTTTCAAGTTGAGTCGAAACCATGTGGACTGGCACAGTGTGGATGAAGTATATCTTTAT
AGTGATGCAACAACATCTAAAATTGCAAGAACAGTTACCCAAAAACTGGGATTTTCTAAA
GCATCAAGTAGTGGTACCAGACTTCATAGAGGTTATGTAGAAGAAGCCACATTAGAAGAC
AAGCCATCACAGACTACCCATATTGTATTTGTTGTGCATGGCATTGGGCAGAAAATGGAC
CAAGGAAGAATTATCAAAAATACAGCTATGATGAGAGAAGCTGCAAGAAAAATAGAAGAA
AGGCATTTTTCCAACCATGCAACACATGTTGAATTTCTGCCTGTTGAGTGGCGGTCAAAA
CTTACTCTTGATGGAGACACTGTTGATTCCATTACTCCTGACAAAGTACGAGGTTTAAGG
GATATGCTGAACAGCAGTGCAATGGACATAATGTATTATACTAGTCCACTTTATAGAGAT
GAACTAGTTAAAGGCCTTCAGCAAGAGCTGAATCGATTGTATTCCCTTTTCTGTTCTCGG
AATCCAGACTTTGAAGAAAAAGGGGGTAAAGTCTCAATAGTATCACATTCCTTGGGATGT
GTAATTACTTATGACATAATGACTGGCTGGAATCCAGTTCGGCTGTATGAACAGTTGCTG
CAAAAGGAAGAAGAGTTGCCTGATGAACGATGGATGAGCTATGAAGAACGACATCTTCTT
GATGAACTCTATATAACTAAACGACGGCTGAAGGAAATAGAAGAACGGCTTCACGGATTG
AAAGCATCATCTATGACACAAACACCTGCCTTAAAATTTAAGGTTGAGAATTTCTTCTGT
ATGGGATCCCCATTAGCAGTTTTCTTGGCGTTGCGTGGCATCCGCCCAGGAAATACTGGA
AGTCAAGACCATATTTTGCCTAGAGAGATTTGTAACCGGTTACTAAATATTTTTCATCCT
ACAGATCCAGTGGCTTATAGATTAGAACCATTAATACTGAAACACTACAGCAACATTTCA
CCTGTCCAGATCCACTGGTACAATACTTCAAATCCTTTACCTTATGAACATATGAAGCCA
AGCTTTCTCAACCCAGCTAAAGAACCTACCTCAGTTTCAGAGAATGAAGGCATTTCAACC
ATACCAAGCCCTGTGACCTCACCAGTTTTGTCCCGCCGACACTATGGAGAATCTATAACA
AATATAGGCAAAGCAAGCATATTAGGGGCTGCTAGCATTGGAAAGGGACTTGGAGGAATG
TTGTTCTCAAGATTTGGACGTTCATCTACAACACAGTCATCTGAAACATCAAAAGACTCA
ATGGAAGATGAGAAGAAGCCAGTTGCCTCACCTTCTGCTACCACCGTAGGGACACAGACC
CTTCCACATAGCAGTTCTGGCTTCCTCGATTCTGCATATTTCAGACTTCAAGAATCGTTC
TTTAATCTCCCACAACTTCTTTTTCCGGAAAATGTAATGCAGAATAAAGATAATGCCCTC
GTGGAGTTGGATCACAGGATTGATTTTGAACTCAGAGAAGGCCTTGTGGAGAGCCGCTAT
TGGTCAGCTGTCACGTCGCATACTGCCTATTGGTCATCCTTGGATGTTGCCCTTTTTCTT
TTAACCTTCATGTATAAACATGAGCACGATGATGATGCAAAACCCAATTTAGATCCAATC
TGA
Protein Properties
Number of Residues 900
Molecular Weight 100434.4
Theoretical pI 5.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phospholipase DDHD1
MNYPGRGSPRSPEHNGRGGGGGAWELGSDARPAFGGGVCCFEHLPGGDPDDGDVPLALLR
GEPGLHLAPGTDDHNHHLALDPCLSDENYDFSSAESGSSLRYYSEGESGGGGSSLSLHPP
QQPPLVPTNSGGGGATGGSPGERKRTRLGGPAARHRYEVVTELGPEEVRWFYKEDKKTWK
PFIGYDSLRIELAFRTLLQTTGARPQGGDRDGDHVCSPTGPASSSGEDDDEDRACGFCQS
TTGHEPEMVELVNIEPVCVRGGLYEVDVTQGECYPVYWNQADKIPVMRGQWFIDGTWQPL
EEEESNLIEQEHLNCFRGQQMQENFDIEVSKSIDGKDAVHSFKLSRNHVDWHSVDEVYLY
SDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLEDKPSQTTHIVFVVHGIGQKMD
QGRIIKNTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLR
DMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGC
VITYDIMTGWNPVRLYEQLLQKEEELPDERWMSYEERHLLDELYITKRRLKEIEERLHGL
KASSMTQTPALKFKVENFFCMGSPLAVFLALRGIRPGNTGSQDHILPREICNRLLNIFHP
TDPVAYRLEPLILKHYSNISPVQIHWYNTSNPLPYEHMKPSFLNPAKEPTSVSENEGIST
IPSPVTSPVLSRRHYGESITNIGKASILGAASIGKGLGGMLFSRFGRSSTTQSSETSKDS
MEDEKKPVASPSATTVGTQTLPHSSSGFLDSAYFRLQESFFNLPQLLFPENVMQNKDNAL
VELDHRIDFELREGLVESRYWSAVTSHTAYWSSLDVALFLLTFMYKHEHDDDAKPNLDPI
GenBank ID Protein 237757346
UniProtKB/Swiss-Prot ID Q8NEL9
UniProtKB/Swiss-Prot Entry Name DDHD1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001160148.1
GeneCard ID DDHD1
GenAtlas ID DDHD1
HGNC ID HGNC:19714
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. [PubMed:11214970 ]
  4. Higgs HN, Han MH, Johnson GE, Glomset JA: Cloning of a phosphatidic acid-preferring phospholipase A1 from bovine testis. J Biol Chem. 1998 Mar 6;273(10):5468-77. [PubMed:9488669 ]
  5. Shimoi W, Ezawa I, Nakamoto K, Uesaki S, Gabreski G, Aridor M, Yamamoto A, Nagahama M, Tagaya M, Tani K: p125 is localized in endoplasmic reticulum exit sites and involved in their organization. J Biol Chem. 2005 Mar 18;280(11):10141-8. Epub 2004 Dec 28. [PubMed:15623529 ]