Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00536
Secondary Accession Numbers
  • 5787
Name Arylacetamide deacetylase
Synonyms Not Available
Gene Name AADAC
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity
Specific Function Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionally causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores.
Pathways Not Available
Reactions
Triacylglycerol + Water → DG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) + a carboxylate details
GO Classification
Biological Process
positive regulation of triglyceride catabolic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
carboxylesterase activity
Molecular Function
carboxylesterase activity
deacetylase activity
retinyl-palmitate esterase activity
serine hydrolase activity
triglyceride lipase activity
Process
metabolic process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass type II membrane protein
  3. Single-pass type II membrane protein
  4. Microsome membrane
Gene Properties
Chromosome Location 3
Locus 3q25.1
SNPs AADAC
Gene Sequence
>1200 bp
ATGGGAAGAAAATCGCTGTACCTTCTGATTGTGGGGATCCTCATAGCATATTATATTTAT
ACGCCTCTCCCAGATAACGTTGAGGAGCCATGGAGAATGATGTGGATAAACGCACATCTG
AAAACTATACAAAATTTGGCTACATTTGTGGAGCTCCTGGGACTTCACCATTTTATGGAT
TCCTTTAAGGTTGTCGGGAGCTTTGATGAAGTCCCACCAACCTCAGATGAAAATGTCACT
GTGACTGAGACAAAATTCAACAACATTCTTGTTCGGGTATATGTGCCAAAGAGAAAGTCT
GAAGCACTAAGAAGGGGGTTGTTTTACATCCATGGTGGAGGCTGGTGCGTGGGAAGTGCT
GCTCTAAGTGGTTATGACTTGCTGTCAAGATGGACAGCAGACAGACTTGATGCTGTCGTC
GTATCAACCAACTACAGATTAGCACCTAAGTATCATTTCCCAATTCAATTTGAAGATGTA
TATAATGCCTTAAGGTGGTTCTTACGTAAAAAAGTTCTTGCAAAATATGGTGTGAACCCT
GAGAGAATCGGTATTTCTGGAGATAGTGCAGGAGGGAATTTAGCTGCAGCAGTGACTCAA
CAGCTCCTTGATGACCCAGATGTCAAGATCAAACTCAAGATCCAGTCTTTAATTTATCCT
GCCCTTCAGCCTCTTGATGTAGATTTACCGTCATATCAAGAAAATTCAAATTTTCTATTT
CTATCCAAATCACTCATGGTCAGATTCTGGAGTGAATATTTTACCACTGATAGATCACTT
GAAAAAGCCATGCTTTCCAGACAACATGTACCTGTGGAATCAAGTCATCTCTTCAAATTT
ATTAATTGGAGTTCCCTGCTCCCTGAGAGGTTTATAAAAGGACATGTTTATAACAATCCA
AATTATGGCAGTTCTGAGCTGGCTAAAAAATATCCAGGGTTCCTAGATGTGAGGGCAGCC
CCTTTGTTGGCTGATGACAACAAATTACGTGGCTTACCCCTGACCTATGTCATCACCTGT
CAATATGATCTCTTAAGAGATGATGGACTCATGTATGTCACCCGACTTCGCAACACTGGG
GTTCAGGTGACTCATAACCATGTTGAGGATGGATTCCATGGAGCATTTTCATTTCTGGGA
CTTAAAATTAGTCACAGACTTATAAATCAGTATATTGAGTGGCTAAAGGAAAATCTATAG
Protein Properties
Number of Residues 399
Molecular Weight 45733.28
Theoretical pI 8.692
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Arylacetamide deacetylase
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMD
SFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSA
ALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNP
ERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLF
LSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP
NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTG
VQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
GenBank ID Protein 158254688
UniProtKB/Swiss-Prot ID P22760
UniProtKB/Swiss-Prot Entry Name AAAD_HUMAN
PDB IDs Not Available
GenBank Gene ID AK290628
GeneCard ID AADAC
GenAtlas ID AADAC
HGNC ID HGNC:17
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Saito S, Iida A, Sekine A, Kawauchi S, Higuchi S, Ogawa C, Nakamura Y: Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population. J Hum Genet. 2003;48(5):249-70. Epub 2003 Apr 29. [PubMed:12721789 ]
  5. Probst MR, Beer M, Beer D, Jeno P, Meyer UA, Gasser R: Human liver arylacetamide deacetylase. Molecular cloning of a novel esterase involved in the metabolic activation of arylamine carcinogens with high sequence similarity to hormone-sensitive lipase. J Biol Chem. 1994 Aug 26;269(34):21650-6. [PubMed:8063807 ]
  6. Probst MR, Jeno P, Meyer UA: Purification and characterization of a human liver arylacetamide deacetylase. Biochem Biophys Res Commun. 1991 May 31;177(1):453-9. [PubMed:2043131 ]
  7. Ross MK, Crow JA: Human carboxylesterases and their role in xenobiotic and endobiotic metabolism. J Biochem Mol Toxicol. 2007;21(4):187-96. [PubMed:17936933 ]
  8. Watanabe A, Fukami T, Nakajima M, Takamiya M, Aoki Y, Yokoi T: Human arylacetamide deacetylase is a principal enzyme in flutamide hydrolysis. Drug Metab Dispos. 2009 Jul;37(7):1513-20. doi: 10.1124/dmd.109.026567. Epub 2009 Apr 1. [PubMed:19339378 ]