Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00607
Secondary Accession Numbers
  • 5879
Name DNA ligase 3
Synonyms
  1. DNA ligase III
  2. Polydeoxyribonucleotide synthase [ATP] 3
Gene Name LIG3
Protein Type Unknown
Biological Properties
General Function Involved in DNA ligase (ATP) activity
Specific Function Interacts with DNA-repair protein XRCC1 and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents.
Pathways
  • Base excision repair
Reactions
Adenosine triphosphate + (deoxyribonucleotide)(n) + (deoxyribonucleotide)(m) → Adenosine monophosphate + Pyrophosphate + (deoxyribonucleotide)(n+m) details
GO Classification
Biological Process
spermatogenesis
cell division
DNA ligation involved in DNA repair
lagging strand elongation
nucleotide-excision repair
reciprocal meiotic recombination
base-excision repair
Cellular Component
chromosome
nucleoplasm
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
dna ligase (atp) activity
ligase activity, forming phosphoric ester bonds
dna ligase activity
nucleic acid binding
dna binding
Molecular Function
DNA ligase (ATP) activity
metal ion binding
ATP binding
zinc ion binding
DNA binding
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna replication
dna ligation
dna ligation involved in dna repair
dna recombination
dna repair
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 17
Locus 17q11.2-q12
SNPs LIG3
Gene Sequence
>3030 bp
ATGTCTTTGGCTTTCAAGATCTTCTTTCCACAAACCCTCCGTGCACTCAGCCGAAAAGAA
CTGTGCCTATTCCGAAAACATCACTGGCGTGATGTAAGACAATTCAGCCAGTGGTCAGAA
ACAGATCTGCTTCATGGACATCCCCTCTTCCTGAGAAGAAAGCCTGTTCTATCATTCCAG
GGAAGCCATCTAAGATCACGTGCCACCTACCTTGTTTTCTTGCCAGGGTTGCATGTGGGA
CTCTGCAGTGGCCCCTGTGAGATGGCTGAGCAACGGTTCTGTGTGGACTATGCCAAGCGT
GGCACAGCTGGCTGCAAAAAATGCAAGGAAAAGATTGTGAAGGGCGTATGCCGAATTGGC
AAAGTGGTGCCCAATCCCTTCTCAGAGTCTGGGGGTGATATGAAAGAGTGGTACCACATT
AAATGCATGTTTGAGAAACTAGAGCGGGCCCGGGCCACCACAAAAAAAATCGAGGACCTC
ACAGAGCTGGAAGGCTGGGAAGAGCTGGAAGATAATGAGAAGGAACAGATAACCCAGCAC
ATTGCAGATCTGTCTTCTAAGGCAGCAGGTACACCAAAGAAGAAAGCTGTTGTCCAGGCT
AAGTTGACAACCACTGGCCAGGTGACTTCTCCAGTGAAAGGCGCCTCATTTGTCACCAGT
ACCAATCCCCGGAAATTTTCTGGCTTTTCAGCCAAGCCCAACAACTCTGGGGAAGCCCCC
TCGAGCCCCACCCCTAAGAGAAGTCTGTCTTCAAGCAAATGTGACCCCAGGCATAAGGAC
TGTCTGCTACGGGAGTTTCGAAAGTTATGCGCCATGGTGGCCGATAATCCTAGCTACAAC
ACGAAGACCCAGATCATCCAGGACTTCCTTCGGAAAGGCTCAGCAGGAGATGGTTTCCAC
GGTGATGTGTACCTAACAGTGAAGCTGCTGCTGCCAGGAGTCATTAAGACTGTTTACAAC
TTGAACGATAAGCAGATTGTGAAGCTTTTCAGTCGCATTTTTAACTGCAACCCAGATGAT
ATGGCACGGGACCTAGAGCAGGGTGACGTGTCAGAGACAATCAGAGTCTTCTTTGAGCAG
AGCAAGTCTTTCCCCCCAGCTGCCAAGAGCCTCCTTACCATCCAGGAAGTGGATGAGTTC
CTTCTGCGGCTGTCCAAGCTCACCAAGGAGGATGAGCAGCAACAGGCCCTACAGGACATT
GCCTCCAGGTGTACAGCCAATGACCTTAAATGCATCATCAGGTTGATCAAACATGATCTG
AAGATGAACTCAGGTGCAAAACATGTGTTAGACGCCCTTGACCCCAATGCCTATGAAGCC
TTCAAAGCCTCGCGCAACCTGCAGGATGTGGTGGAGCGGGTCCTTCACAACGCGCAGGAG
GTGGAGAAGGAGCCGGGCCAGAGACGAGCTCTGAGCGTCCAGGCCTCGCTGATGACACCT
GTGCAGCCCATGTTGGCGGAGGCCTGCAAGTCCGTTGAGTATGCAATGAAGAAATGTCCC
AATGGCATGTTCTCTGAGATCAAGTACGATGGAGAGCGAGTCCAGGTGCATAAGAATGGA
GACCACTTCAGCTACTTCAGCCGCAGTCTCAAGCCCGTCCTTCCTCACAAGGTGGCCCAC
TTTAAGGACTACATTCCCCAGGCTTTTCCTGGGGGCCACAGCATGATCTTGGATTCTGAA
GTGCTTCTGATTGACAACAAGACAGGCAAACCACTGCCCTTTGGGACTCTGGGAGTACAC
AAGAAAGCAGCCTTCCAGGATGCTAATGTCTGCCTGTTTGTTTTTGATTGTATCTACTTT
AATGATGTCAGCTTGATGGACAGACCTCTGTGTGAGCGGCGGAAGTTTCTTCATGACAAC
ATGGTTGAAATTCCAAACCGGATCATGTTCTCAGAAATGAAGCGAGTCACAAAAGCTTTG
GACTTGGCTGACATGATAACCCGGGTGATCCAGGAGGGATTGGAGGGGCTGGTGCTGAAG
GATGTGAAGGGTACATATGAGCCTGGGAAGCGGCACTGGCTGAAAGTGAAGAAAGACTAT
TTGAACGAGGGGGCCATGGCCGACACAGCTGACCTGGTGGTCCTTGGAGCCTTCTATGGG
CAAGGGAGCAAAGGCGGCATGATGTCAATCTTCCTCATGGGCTGCTACGACCCTGGCAGC
CAGAAGTGGTGCACAGTCACCAAGTGTGCAGGAGGCCATGATGATGCCACGCTTGCCCGC
CTGCAGAATGAACTAGACATGGTGAAGATCAGCAAGGACCCCAGCAAAATACCCAGCTGG
TTGAAGGTCAACAAGATCTACTATCCTGACTTCATCGTCCCAGACCCAAAGAAAGCTGCC
GTGTGGGAGATCACAGGGGCTGAATTCTCCAAATCGGAGGCTCATACAGCTGACGGGATC
TCCATCCGATTCCCTCGCTGCACCCGAATCCGAGATGATAAGGACTGGAAATCTGCCACT
AACCTTCCCCAACTCAAGGAACTGTACCAGTTGTCCAAGGAGAAGGCAGACTTCACTGTA
GTGGCTGGAGATGAGGGGAGCTCCACTACAGGGGGTAGCAGTGAAGAGAATAAGGGTCCC
TCAGGGTCTGCTGTGTCCCGCAAGGCCCCCAGCAAGCCCTCAGCCAGTACCAAGAAAGCA
GAAGGGAAGCTGAGTAACTCCAACAGCAAAGATGGCAACATGCAGACTGCAAAGCCTTCC
GCTATGAAGGTGGGGGAGAAGCTGGCCACAAAGTCTTCTCCAGTGAAAGTAGGGGAGAAG
CGGAAAGCTGCTGATGAGACGCTGTGCCAAACAAAGGTATTGCTGGACATCTTCACTGGG
GTGCGGCTTTACTTGCCACCCTCCACACCAGACTTCAGCCGTCTCAGACGCTACTTTGTG
GCATTCGACGGGGACCTGGTACAGGAATTTGATATGACTTCAGCCACGCACGTGCTGGGT
AGCAGGGACAAGAACCCTGCGGCCCAGCAGGTCTCCCCAGAGTGGATTTGGGCATGTATC
CGGAAACGGAGACTGGTAGCTCCCTGCTAG
Protein Properties
Number of Residues 1009
Molecular Weight 106017.03
Theoretical pI 9.152
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>DNA ligase 3
MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQ
GSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
AMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
GenBank ID Protein 73747829
UniProtKB/Swiss-Prot ID P49916
UniProtKB/Swiss-Prot Entry Name DNLI3_HUMAN
PDB IDs
GenBank Gene ID NM_013975.3
GeneCard ID LIG3
GenAtlas ID LIG3
HGNC ID HGNC:6600
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  8. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  10. Wei YF, Robins P, Carter K, Caldecott K, Pappin DJ, Yu GL, Wang RP, Shell BK, Nash RA, Schar P, et al.: Molecular cloning and expression of human cDNAs encoding a novel DNA ligase IV and DNA ligase III, an enzyme active in DNA repair and recombination. Mol Cell Biol. 1995 Jun;15(6):3206-16. [PubMed:7760816 ]
  11. Chen J, Tomkinson AE, Ramos W, Mackey ZB, Danehower S, Walter CA, Schultz RA, Besterman JM, Husain I: Mammalian DNA ligase III: molecular cloning, chromosomal localization, and expression in spermatocytes undergoing meiotic recombination. Mol Cell Biol. 1995 Oct;15(10):5412-22. [PubMed:7565692 ]
  12. Thornton KH, Krishnan VV, West MG, Popham J, Ramirez M, Thelen MP, Cosman M: Expression, purification, and biophysical characterization of the BRCT domain of human DNA ligase IIIalpha. Protein Expr Purif. 2001 Apr;21(3):401-11. [PubMed:11281714 ]
  13. Kulczyk AW, Yang JC, Neuhaus D: Solution structure and DNA binding of the zinc-finger domain from DNA ligase IIIalpha. J Mol Biol. 2004 Aug 13;341(3):723-38. [PubMed:15288782 ]