Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00619
Secondary Accession Numbers
  • 5891
Name Tyrosine--tRNA ligase, mitochondrial
Synonyms
  1. TyrRS
  2. Tyrosine--tRNA ligase
  3. Tyrosyl-tRNA synthetase
Gene Name YARS2
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr) (By similarity).
Pathways
  • Aminoacyl-tRNA biosynthesis
Reactions
Adenosine triphosphate + L-Tyrosine + tRNA(Tyr) → Adenosine monophosphate + Pyrophosphate + L-tyrosyl-tRNA(Tyr) details
Adenosine triphosphate + L-Tyrosine + tRNA(Tyr) → Adenosine monophosphate + Pyrophosphate + L-Tyrosyl-tRNA(Tyr) details
GO Classification
Biological Process
mitochondrial tyrosyl-tRNA aminoacylation
Cellular Component
mitochondrial matrix
Component
cell part
intracellular part
cytoplasm
Function
binding
nucleotide binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
tyrosine-trna ligase activity
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-trna and related compounds
aminoacyl-trna ligase activity
Molecular Function
ATP binding
tyrosine-tRNA ligase activity
tyrosine binding
tRNA binding
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna aminoacylation
trna aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
tyrosyl-trna aminoacylation
biosynthetic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 12
Locus 12p11.21
SNPs YARS2
Gene Sequence
>1434 bp
ATGGCGGCGCCCATCTTGCGGTCCTTTTCCTGGGGCCGGTGGTCTGGTACCCTAAATCTC
TCAGTATTGTTGCCCTTGGGGCTGCGTAAGGCCCACTCGGGCGCTCAGGGGTTACTGGCA
GCGCAGAAGGCTCGAGGTCTGTTCAAGGACTTCTTCCCGGAGACGGGGACGAAAATAGAG
CTCCCAGAGCTCTTCGACCGTGGCACGGCGAGTTTTCCCCAAACCATTTACTGTGGCTTC
GACCCCACGGCAGACTCGCTTCATGTGGGTCATCTACTTGCGCTGCTGGGCCTGTTTCAT
TTGCAGCGAGCGGGCCACAACGTGATCGCGCTGGTGGGAGGCGCCACGGCGCGCCTGGGA
GACCCGAGCGGCCGTACCAAGGAACGCGAGGCGCTGGAGACAGAGCGCGTGCGAGCCAAC
GCGCGAGCTCTGCGCCTAGGGCTTGAGGCCCTGGCGGCTAATCACCAGCAGCTTTTCACT
GATGGGCGCTCCTGGGGCAGCTTCACTGTGCTGGACAACTCGGCCTGGTACCAGAAGCAG
CACCTGGTGGACTTCCTGGCGGCAGTGGGGGGTCACTTCCGCATGGGGACGCTGCTGAGC
CGGCAGAGCGTGCAGCTGCGGCTCAAGAGCCCCGAGGGCATGAGCTTGGCCGAGTTCTTT
TACCAGGTGCTCCAGGCCTATGACTTCTATTACCTCTTCCAGCGTTATGGATGCAGGGTC
CAGCTGGGCGGATCTGATCAACTAGGCAACATCATGTCCGGATATGAGTTCATCAACAAG
TTGACTGGAGAAGATGTATTTGGAATCACCGTTCCTCTAATTACAAGTACAACTGGAGCA
AAGCTGGGAAAGTCTGCTGGCAACGCTGTTTGGCTAAACAGAGATAAGACATCTCCATTT
GAATTGTATCAATTCTTTGTCAGGCAACCGGACGATTCAGTGGAAAGGTACCTGAAGCTG
TTCACTTTCCTGCCCCTTCCAGAGATTGATCATATCATGCAGCTGCATGTCAAAGAGCCA
GAAAGGCGGGGTCCTCAGAAACGACTGGCAGCAGAAGTAACAAAGCTTGTTCATGGACGA
GAAGGATTGGATTCTGCTAAAAGGTGTACACAAGCCCTTTATCACAGTAGCATAGATGCA
CTGGAGGTCATGTCTGATCAGGAGTTAAAAGAGTTGTTTAAAGAAGCTCCATTTTCTGAA
TTTTTTCTCGATCCTGGAACAAGTGTCCTAGATACTTGCCGCAAAGCAAATGCCATTCCA
GATGGTCCCCGAGGGTATCGAATGATAACAGAAGGCGGAGTCAGCATAAATCACCAACAA
GTAACAAATCCTGAGAGTGTTTTAATTGTTGGACAACATATTCTCAAGAATGGACTTTCC
TTACTTAAAATAGGAAAAAGAAATTTCTACATTATAAAATGGCTTCAGTTGTGA
Protein Properties
Number of Residues 477
Molecular Weight 53198.56
Theoretical pI 8.976
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosyl-tRNA synthetase, mitochondrial
MAAPILRSFSWGRWSGTLNLSVLLPLGLRKAHSGAQGLLAAQKARGLFKDFFPETGTKIE
LPELFDRGTASFPQTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATARLG
DPSGRTKEREALETERVRANARALRLGLEALAANHQQLFTDGRSWGSFTVLDNSAWYQKQ
HLVDFLAAVGGHFRMGTLLSRQSVQLRLKSPEGMSLAEFFYQVLQAYDFYYLFQRYGCRV
QLGGSDQLGNIMSGYEFINKLTGEDVFGITVPLITSTTGAKLGKSAGNAVWLNRDKTSPF
ELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVHGR
EGLDSAKRCTQALYHSSIDALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIP
DGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSLLKIGKRNFYIIKWLQL
GenBank ID Protein 94681057
UniProtKB/Swiss-Prot ID Q9Y2Z4
UniProtKB/Swiss-Prot Entry Name SYYM_HUMAN
PDB IDs
GenBank Gene ID NM_001040436.1
GeneCard ID YARS2
GenAtlas ID YARS2
HGNC ID HGNC:24249
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  5. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 2000 May;10(5):703-13. [PubMed:10810093 ]
  6. Bonnefond L, Fender A, Rudinger-Thirion J, Giege R, Florentz C, Sissler M: Toward the full set of human mitochondrial aminoacyl-tRNA synthetases: characterization of AspRS and TyrRS. Biochemistry. 2005 Mar 29;44(12):4805-16. [PubMed:15779907 ]