Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00660
Secondary Accession Numbers
  • 5932
Name DNA ligase 1
Synonyms
  1. DNA ligase I
  2. Polydeoxyribonucleotide synthase [ATP] 1
Gene Name LIG1
Protein Type Enzyme
Biological Properties
General Function Involved in DNA ligase (ATP) activity
Specific Function DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair.
Pathways
  • Base excision repair
  • DNA replication
  • Mismatch repair
  • Nucleotide Excision Repair
  • Nucleotide excision repair
Reactions
Adenosine triphosphate + (deoxyribonucleotide)(n) + (deoxyribonucleotide)(m) → Adenosine monophosphate + Pyrophosphate + (deoxyribonucleotide)(n+m) details
GO Classification
Biological Process
cell division
telomere maintenance via recombination
telomere maintenance via semi-conservative replication
DNA ligation involved in DNA repair
lagging strand elongation
nucleotide-excision repair, DNA gap filling
transcription-coupled nucleotide-excision repair
S phase of mitotic cell cycle
anatomical structure morphogenesis
double-strand break repair via homologous recombination
base-excision repair
Cellular Component
chromosome
mitochondrion
nucleoplasm
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
dna ligase (atp) activity
ligase activity, forming phosphoric ester bonds
dna ligase activity
nucleic acid binding
dna binding
Molecular Function
DNA ligase (ATP) activity
metal ion binding
ATP binding
DNA binding
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna replication
dna ligation
dna ligation involved in dna repair
dna recombination
dna repair
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 19
Locus 19q13.2-q13.3
SNPs LIG1
Gene Sequence
>2760 bp
ATGCAGCGAAGTATCATGTCATTTTTCCACCCCAAGAAAGAGGGTAAAGCAAAGAAGCCT
GAGAAGGAGGCATCCAATAGCAGCAGAGAGACGGAGCCCCCTCCAAAGGCGGCACTGAAG
GAGTGGAATGGAGTGGTGTCCGAGAGTGACTCTCCGGTGAAGAGGCCAGGGAGGAAGGCG
GCCCGGGTCCTGGGCAGCGAAGGGGAAGAGGAGGATGAAGCCCTTAGCCCTGCTAAAGGC
CAGAAGCCTGCCCTGGACTGCTCACAGGTCTCCCCGCCCCGTCCTGCCACATCTCCTGAG
AACAATGCTTCCCTCTCTGACACCTCTCCCATGGACAGTTCCCCATCAGGGATTCCGAAG
CGTCGCACAGCTCGGAAGCAGCTCCCGAAACGGACCATTCAGGAAGTCCTGGAAGAGCAG
AGTGAGGACGAGGACAGAGAAGCCAAGAGGAAGAAGGAGGAGGAAGAAGAGGAGACCCCG
AAAGAAAGCCTCACAGAGGCTGAAGTGGCAACAGAGAAGGAAGGAGAAGACGGGGACCAG
CCCACCACGCCTCCCAAGCCCCTAAAGACCTCCAAAGCAGAGACCCCGACGGAAAGCGTT
TCAGAGCCTGAGGTGGCCACGAAGCAGGAACTGCAGGAGGAGGAAGAGCAGACCAAGCCT
CCCCGCAGAGCTCCCAAGACGCTCAGCAGCTTCTTCACCCCCCGGAAGCCAGCAGTCAAA
AAAGAAGTGAAGGAAGAGGAGCCAGGGGCTCCAGGAAAGGAGGGAGCTGCTGAGGGACCC
CTGGATCCATCTGGTTACAATCCTGCCAAGAACAACTATCATCCCGTGGAAGATGCCTGC
TGGAAACCGGGCCAGAAGGTTCCTTACCTGGCTGTGGCCCGGACGTTTGAGAAGATCGAG
GAGGTGTCTGCTCGGCTCCGGATGGTGGAGACGCTGAGCAACTTGCTGCGCTCCGTGGTG
GCCCTGTCGCCTCCAGACCTCCTCCCTGTCCTCTACCTCAGCCTCAACCACCTTGGGCCA
CCCCAGCAGGGCCTGGAGCTTGGCGTGGGTGATGGTGTCCTTCTCAAGGCAGTGGCCCAG
GCCACAGGTCGGCAGCTGGAGTCCGTCCGGGCTGAGGCAGCCGAGAAAGGCGACGTGGGG
CTGGTGGCCGAGAACAGCCGCAGCACCCAGAGGCTCATGCTGCCACCACCTCCGCTCACT
GCCTCCGGGGTCTTCAGCAAGTTCCGCGACATCGCCAGGCTCACTGGCAGTGCTTCCACA
GCCAAGAAGATAGACATCATCAAAGGCCTCTTTGTGGCCTGCCGCCACTCAGAAGCCCGG
TTCATCGCTAGGTCCCTGAGCGGACGGCTGCGCCTTGGGCTGGCAGAGCAGTCGGTGCTG
GCTGCCCTCTCCCAGGCAGTGAGCCTCACGCCCCCGGGCCAAGAATTCCCACCAGCCATG
GTGGATGCTGGGAAGGGCAAGACAGCAGAGGCCAGAAAGACGTGGCTGGAGGAGCAAGGC
ATGATCCTGAAGCAGACGTTCTGCGAGGTTCCCGACCTGGACCGAATTATCCCCGTGCTG
CTGGAGCACGGCCTGGAACGTCTCCCGGAGCACTGCAAGCTGAGCCCAGGGATTCCCCTG
AAACCAATGTTGGCCCATCCCACCCGGGGCATCAGCGAGGTCCTGAAACGCTTTGAGGAG
GCAGCTTTCACCTGCGAATACAAATATGACGGGCAGAGGGCACAGATCCACGCCCTGGAA
GGCGGGGAGGTGAAGATCTTCAGCAGGAATCAGGAAGACAACACTGGGAAGTACCCGGAC
ATCATCAGCCGCATCCCCAAGATTAAACTCCCATCGGTCACATCCTTCATCCTGGACACC
GAAGCCGTGGCTTGGGACCGGGAAAAGAAGCAGATCCAGCCATTCCAAGTGCTCACCACC
CGCAAACGCAAGGAGGTGGATGCGTCTGAGATCCAGGTGCAGGTGTGTTTGTACGCCTTC
GACCTCATCTACCTCAATGGAGAGTCCCTGGTACGTGAGCCCCTTTCCCGGCGCCGGCAG
CTGCTCCGGGAGAACTTTGTGGAGACAGAGGGCGAGTTTGTCTTCGCCACCTCCCTGGAC
ACCAAGGACATCGAGCAGATCGCCGAGTTCCTGGAGCAGTCAGTGAAAGACTCCTGCGAG
GGGCTGATGGTGAAGACCCTGGATGTTGATGCCACCTACGAGATCGCCAAGAGATCGCAC
AACTGGCTCAAGCTGAAGAAGGACTACCTTGATGGCGTGGGTGACACCCTGGACCTGGTG
GTGATCGGCGCCTACCTGGGCCGGGGGAAGCGGGCCGGCCGGTACGGGGGCTTCCTGCTG
GCCTCCTACGACGAGGACAGTGAGGAGCTGCAGGCCATATGCAAGCTTGGAACTGGCTTC
AGTGATGAGGAGCTGGAGGAGCATCACCAGAGCCTCAAGGCGCTGGTGCTGCCCAGCCCA
CGCCCTTACGTGCGGATAGATGGCGCTGTGATTCCCGACCACTGGCTGGACCCCAGCGCT
GTGTGGGAGGTGAAGTGCGCTGACCTCTCCCTCTCTCCCATCTACCCTGCTGCGCGGGGC
CTGGTGGATAGTGACAAGGGCATCTCCCTTCGCTTCCCTCGGTTTATTCGAGTCCGTGAA
GACAAGCAGCCGGAGCAGGCCACCACCAGTGCTCAGGTGGCCTGTTTGTACCGGAAGCAA
AGTCAGATTCAGAACCAACAAGGCGAGGACTCAGGCTCTGACCCTGAAGATACCTACTAA
Protein Properties
Number of Residues 919
Molecular Weight 101735.11
Theoretical pI 5.62
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>DNA ligase 1
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQ
PTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAM
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
GenBank ID Protein 187143
UniProtKB/Swiss-Prot ID P18858
UniProtKB/Swiss-Prot Entry Name DNLI1_HUMAN
PDB IDs
GenBank Gene ID M36067
GeneCard ID LIG1
GenAtlas ID LIG1
HGNC ID HGNC:6598
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  8. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  9. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  10. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  11. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  12. Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R: Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction. Mol Cell Proteomics. 2007 Nov;6(11):1952-67. Epub 2007 Aug 12. [PubMed:17693683 ]
  13. Barnes DE, Johnston LH, Kodama K, Tomkinson AE, Lasko DD, Lindahl T: Human DNA ligase I cDNA: cloning and functional expression in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A. 1990 Sep;87(17):6679-83. [PubMed:2204063 ]
  14. Petrini JH, Huwiler KG, Weaver DT: A wild-type DNA ligase I gene is expressed in Bloom's syndrome cells. Proc Natl Acad Sci U S A. 1991 Sep 1;88(17):7615-9. [PubMed:1881902 ]
  15. Tan F, Lu L, Cai Y, Wang J, Xie Y, Wang L, Gong Y, Xu BE, Wu J, Luo Y, Qiang B, Yuan J, Sun X, Peng X: Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells. Proteomics. 2008 Jul;8(14):2885-96. doi: 10.1002/pmic.200700887. [PubMed:18655026 ]
  16. Pascal JM, O'Brien PJ, Tomkinson AE, Ellenberger T: Human DNA ligase I completely encircles and partially unwinds nicked DNA. Nature. 2004 Nov 25;432(7016):473-8. [PubMed:15565146 ]
  17. Barnes DE, Tomkinson AE, Lehmann AR, Webster AD, Lindahl T: Mutations in the DNA ligase I gene of an individual with immunodeficiencies and cellular hypersensitivity to DNA-damaging agents. Cell. 1992 May 1;69(3):495-503. [PubMed:1581963 ]