Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00679
Secondary Accession Numbers
  • 5952
Name Protein-glutamine gamma-glutamyltransferase 5
Synonyms
  1. TG(X)
  2. TGX
  3. TGase X
  4. TGase-5
  5. Transglutaminase X
  6. Transglutaminase-5
Gene Name TGM5
Protein Type Unknown
Biological Properties
General Function Involved in protein-glutamine gamma-glutamyltransferase activity
Specific Function Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. Contributes to the formation of the cornified cell envelope of keratinocytes.
Pathways Not Available
Reactions
Protein glutamine + alkylamine → protein N(5)-alkylglutamine + Ammonia details
GO Classification
Biological Process
cellular protein modification process
peptide cross-linking
epidermis development
Cellular Component
cytoplasm
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring amino-acyl groups
protein-glutamine gamma-glutamyltransferase activity
Molecular Function
metal ion binding
protein-glutamine gamma-glutamyltransferase activity
Process
metabolic process
macromolecule metabolic process
post-translational protein modification
peptide cross-linking
macromolecule modification
protein modification process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 15
Locus 15q15.2
SNPs TGM5
Gene Sequence
>2163 bp
ATGGCCCAAGGGCTAGAAGTGGCCCTCACAGACCTCCAGAGCTCCAGAAATAATGTGCGG
CACCACACGGAGGAGATCACTGTGGACCACCTGCTTGTTCGCCGGGGCCAGGCCTTCAAC
CTCACCCTGTACTTCAGGAACCGGAGCTTCCAGCCAGGCCTGGACAACATCATCTTCGTG
GTTGAAACTGGACCGCTGTCAGACCTGGCCTTGGGGACTCGGGCTGTGTTCAGCCTGGCA
CGCCATCACAGCCCCAGCCCCTGGATTGCCTGGCTGGAGACCAATGGGGCCACCTCCACA
GAGGTGAGCTTGTGCGCTCCTCCCACGGCGGCCGTGGGTCGGTACCTCTTGAAAATCCAC
ATCGACTCCTTCCAGGGGTCTGTGACGGCCTACCAGCTAGGGGAGTTCATCCTGCTTTTC
AATCCCTGGTGCCCAGAGGATGCTGTCTACTTGGACAGTGAACCCCAGAGGCAGGAGTAT
GTCATGAATGATTATGGCTTCATCTACCAAGGCAGCAAGAACTGGATCCGCCCATGTCCC
TGGAACTATGGACAGTTTGAAGACAAAATCATAGACATCTGCCTGAAGCTGCTAGACAAG
AGCCTGCACTTCCAGACTGACCCAGCCACAGACTGTGCTCTGCGGGGAAGCCCCGTCTAC
GTCAGCAGAGTGGTGTGTGCCATGATCAACAGCAATGATGATAATGGGGTGCTCAATGGA
AACTGGAGTGAGAATTACACAGACGGCGCCAACCCTGCGGAGTGGACGGGCAGCGTGGCC
ATCCTGAAGCAGTGGAACGCCACAGGCTGCCAGCCCGTGCGCTACGGGCAATGCTGGGTC
TTTGCTGCCGTCATGTGCACAGTGATGAGGTGTCTGGGGATCCCTACCCGTGTGATCACC
AACTTCGACTCTGGCCACGATACAGATGGAAACCTGATCATAGATGAGTATTATGACAAC
ACAGGCAGGATTTTGGGGAATAAGAAGAAGGATACTATCTGGAACTTCCATGTCTGGAAT
GAGTGCTGGATGGCCCGGAAGGATCTGCCCCCTGCATATGGAGGCTGGCAGGTGCTGGAC
GCCACACCTCAGGAGATGAGCAACGGCGTCTACTGCTGTGGCCCTGCCTCTGTCAGAGCC
ATCAAAGAAGGAGAAGTGGACCTGAACTATGACACGCCCTTTGTGTTTTCGATGGTGAAT
GCTGACTGCATGTCCTGGCTCGTCCAGGGAGGGAAGGAGCAGAAGCTTCACCAGGACACG
AGTTCTGTTGGCAATTTTATCAGCACAAAGAGCATCCAGAGTGACGAGCGGGATGACATC
ACAGAGAACTACAAGTATGAAGAAGGATCCCTCCAGGAGAGGCAGGTGTTTCTGAAGGCT
CTGCAGAAGCTGAAGGCTAGAAGCTTCCATGGCTCCCAAAGAGGAGCAGAGTTGCAACCT
TCCAGGCCCACATCACTGAGCCAGGACAGCCCTCGGAGCCTGCATACACCTTCCCTTCGA
CCCAGTGATGTGGTGCAAGTCTCCCTGAAATTCAAGCTGCTCGACCCGCCCAACATGGGC
CAGGATATATGCTTTGTCCTGCTGGCCCTCAACATGTCCTCCCAGTTCAAGGACCTCAAA
GTGAACCTGAGTGCCCAGTCTCTGCTGCACGATGGCAGCCCCCTGTCCCCATTCTGGCAG
GACACAGCGTTCATCACACTCTCTCCTAAAGAAGCAAAGACCTACCCCTGCAAAATCTCC
TATTCCCAGTACAGCCAGTACCTGTCAACAGACAAGCTGATCCGCATCAGTGCCCTGGGT
GAAGAGAAAAGCAGTCCTGAGAAAATCCTGGTGAACAAGATCATCACCTTATCTTATCCA
AGCATCACGATTAATGTTCTAGGAGCAGCCGTTGTGAACCAGCCACTCTCCATACAGGTG
ATATTTTCAAACCCCCTCTCGGAGCAGGTTGAGGACTGTGTGCTGACTGTGGAAGGAAGT
GGCCTCTTCAAGAAACAGCAGAAAGTCTTCCTTGGAGTCCTCAAACCCCAACACCAAGCA
AGCATCATTCTGGAGACCGTCCCCTTCAAGAGTGGACAAAGGCAGATCCAAGCTAATATG
AGAAGCAACAAGTTTAAGGACATTAAGGGTTACAGGAATGTTTATGTAGACTTTGCATTA
TAA
Protein Properties
Number of Residues 720
Molecular Weight 71918.045
Theoretical pI 6.359
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Protein-glutamine gamma-glutamyltransferase 5
MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRSFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPAYGGWQVLD
ATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQP
SRPTSLSQDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGS
GLFKKQQKVFLGVLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
GenBank ID Protein 2895530
UniProtKB/Swiss-Prot ID O43548
UniProtKB/Swiss-Prot Entry Name TGM5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF035960
GeneCard ID TGM5
GenAtlas ID TGM5
HGNC ID HGNC:11781
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Aeschlimann D, Koeller MK, Allen-Hoffmann BL, Mosher DF: Isolation of a cDNA encoding a novel member of the transglutaminase gene family from human keratinocytes. Detection and identification of transglutaminase gene products based on reverse transcription-polymerase chain reaction with degenerate primers. J Biol Chem. 1998 Feb 6;273(6):3452-60. [PubMed:9452468 ]
  3. Grenard P, Bates MK, Aeschlimann D: Evolution of transglutaminase genes: identification of a transglutaminase gene cluster on human chromosome 15q15. Structure of the gene encoding transglutaminase X and a novel gene family member, transglutaminase Z. J Biol Chem. 2001 Aug 31;276(35):33066-78. Epub 2001 Jun 4. [PubMed:11390390 ]
  4. Rufini A, Vilbois F, Paradisi A, Oddi S, Tartaglione R, Leta A, Bagetta G, Guerrieri P, Finazzi-Agro' A, Melino G, Candi E: Transglutaminase 5 is acetylated at the N-terminal end. Amino Acids. 2004 Jul;26(4):425-30. Epub 2004 Jun 17. [PubMed:15290349 ]
  5. Cassidy AJ, van Steensel MA, Steijlen PM, van Geel M, van der Velden J, Morley SM, Terrinoni A, Melino G, Candi E, McLean WH: A homozygous missense mutation in TGM5 abolishes epidermal transglutaminase 5 activity and causes acral peeling skin syndrome. Am J Hum Genet. 2005 Dec;77(6):909-17. Epub 2005 Oct 11. [PubMed:16380904 ]