Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00683
Secondary Accession Numbers
  • 5956
Name Histidine ammonia-lyase
Synonyms
  1. Histidase
Gene Name HAL
Protein Type Enzyme
Biological Properties
General Function Involved in histidine ammonia-lyase activity
Specific Function Not Available
Pathways
  • Ammonia Recycling
  • Histidine Metabolism
  • Histidine metabolism
  • Histidinemia
  • L-histidine degradation into L-glutamate
Reactions
L-Histidine → Urocanic acid + Ammonia details
GO Classification
Biological Process
histidine catabolic process to glutamate and formamide
histidine catabolic process to glutamate and formate
biosynthetic process
histidine catabolic process
Cellular Component
cytosol
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
lyase activity
carbon-nitrogen lyase activity
ammonia-lyase activity
histidine ammonia-lyase activity
Molecular Function
histidine ammonia-lyase activity
Process
metabolic process
cellular metabolic process
biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
histidine family amino acid metabolic process
histidine metabolic process
histidine catabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q22-q24.1
SNPs HAL
Gene Sequence
>1974 bp
ATGCCCAGATACACGGTGCACGTACGTGGGGAATGGCTGGCAGTGCCCTGCCAGGACGCG
CAGCTCACTGTGGGCTGGCTGGGCCGGGAGGCCGTGAGGCGCTATATCAAGAATAAGCCC
GACAATGGTGGCTTCACCTCCGTGGATGACGCGCACTTCCTTGTGCGCCGGTGCAAGGGC
CTGGGCCTGCTGGACAACGAGGACCGGCTCGAGGTGGCCCTAGAGAACAACGAGTTCGTG
GAAGTGGTTATAGAGGGTGATGCCATGTCTCCTGACTTCATTCCATCTCAACCAGAAGGA
GTTTATCTATACAGCAAGTACCGGGAGCCTGAAAAGTACATCGAGTTAGATGGAGACCGT
CTGACCACGGAGGATCTGGTCAACTTGGGAAAGGGACGCTACAAAATAAAGCTCACCCCA
ACAGCTGAGAAGAGGGTGCAGAAATCCAGGGAGGTCATAGATAGCATCATAAAAGAGAAA
ACAGTTGTTTACGGTATTACTACAGGTTTTGGGAAATTTGCCAGAACTGTAATTCCTATC
AATAAGCTACAGGAGCTTCAGGTCAACTTAGTACGCTCACATTCTTCAGGTGTTGGGAAA
CCACTAAGTCCTGAGAGGTGTCGGATGCTCTTGGCTTTAAGGATCAATGTCTTAGCCAAA
GGATACAGTGGCATTTCCCTGGAGACCCTCAAACAAGTCATAGAAATGTTTAATGCCTCC
TGCCTGCCCTATGTCCCAGAGAAAGGAACCGTTGGTGCCAGTGGAGACCTTGCCCCACTC
TCTCATCTTGCTCTTGGGCTAGTTGGAGAAGGGAAGATGTGGTCTCCGAAGAGTGGCTGG
GCTGATGCTAAATACGTGCTAGAAGCCCATGGATTGAAACCAGTTATTTTAAAACCAAAA
GAGGGCCTGGCACTCATCAATGGGACGCAGATGATCACATCCCTGGGCTGTGAAGCTGTA
GAGCGAGCCAGTGCTATTGCACGGCAGGCTGACATTGTGGCAGCCCTGACCCTTGAGGTG
CTGAAGGGCACCACCAAAGCCTTTGACACTGACATTCATGCTCTTCGACCTCACCGTGGG
CAAATTGAAGTTGCTTTTCGGTTTCGGTCACTCTTGGACTCAGATCACCACCCATCAGAA
ATAGCAGAGAGTCACAGGTTCTGTGATCGCGTCCAGGATGCATACACCTTGCGCTGCTGT
CCACAGGTCCATGGTGTGGTGAATGATACAATAGCATTTGTGAAGAACATCATTACCACA
GAACTGAACAGCGCAACAGATAATCCTATGGTCTTTGCCAATAGGGGAGAGACAGTTTCT
GGAGGAAACTTCCATGGTGAATACCCAGCCAAAGCCCTAGACTACTTGGCCATTGGCATC
CATGAACTTGCTGCAATCAGTGAGAGAAGAATCGAGCGGCTCTGCAATCCCTCCCTCAGT
GAGCTGCCTGCCTTCCTGGTGGCTGAAGGTGGTCTGAACTCTGGGTTCATGATAGCTCAC
TGCACGGCAGCAGCCCTTGTTTCTGAGAACAAGGCTCTGTGCCATCCCTCGTCTGTTGAC
TCCCTCTCCACCAGCGCAGCCACGGAGGACCACGTCTCCATGGGAGGATGGGCAGCAAGG
AAAGCCCTCAGGGTCATCGAGCATGTGGAGCAAGTGCTGGCCATCGAGCTCCTTGCAGCC
TGCCAGGGCATAGAGTTTCTACGTCCCCTGAAAACAACCACTCCGCTGGAGAAGGTCTAT
GACCTGGTGCGCTCTGTTGTAAGGCCCTGGATAAAAGATCGCTTCATGGCCCCGGACATC
GAGGCAGCCCACAGGCTGCTCCTGGAGCAGAAGGTTTGGGAAGTAGCTGCTCCATACATT
GAAAAATACAGAATGGAGCATATTCCAGAATCAAGACCTCTTTCTCCAACAGCCTTTTCA
CTGCAATTTCTGCACAAGAAATCCACCAAAATCCCGGAGTCTGAGGACCTTTAA
Protein Properties
Number of Residues 657
Molecular Weight 49122.09
Theoretical pI 6.665
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histidine ammonia-lyase
MPRYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKG
LGLLDNEDRLEVALENNEFVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDR
LTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTVIPI
NKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNAS
CLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPK
EGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHALRPHRG
QIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITT
ELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNPSLS
ELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAAR
KALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDI
EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P42357
UniProtKB/Swiss-Prot Entry Name HUTH_HUMAN
PDB IDs Not Available
GenBank Gene ID D16626
GeneCard ID HAL
GenAtlas ID HAL
HGNC ID HGNC:4806
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Suchi M, Harada N, Wada Y, Takagi Y: Molecular cloning of a cDNA encoding human histidase. Biochim Biophys Acta. 1993 Nov 16;1216(2):293-5. [PubMed:7916645 ]
  3. Suchi M, Sano H, Mizuno H, Wada Y: Molecular cloning and structural characterization of the human histidase gene (HAL). Genomics. 1995 Sep 1;29(1):98-104. [PubMed:8530107 ]
  4. Kawai Y, Moriyama A, Asai K, Coleman-Campbell CM, Sumi S, Morishita H, Suchi M: Molecular characterization of histidinemia: identification of four missense mutations in the histidase gene. Hum Genet. 2005 Apr;116(5):340-6. Epub 2005 Jan 27. [PubMed:15806399 ]