Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00685
Secondary Accession Numbers
  • 5958
  • HMDBP03769
Name GMP reductase 1
Synonyms
  1. Guanosine 5'-monophosphate oxidoreductase 1
  2. Guanosine monophosphate reductase 1
Gene Name GMPR
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.
Pathways
  • Adenine phosphoribosyltransferase deficiency (APRT)
  • Adenosine Deaminase Deficiency
  • Adenylosuccinate Lyase Deficiency
  • AICA-Ribosiduria
  • Azathioprine Action Pathway
  • Gout or Kelley-Seegmiller Syndrome
  • Lesch-Nyhan Syndrome (LNS)
  • Mercaptopurine Action Pathway
  • Mitochondrial DNA depletion syndrome
  • Molybdenum Cofactor Deficiency
  • Myoadenylate deaminase deficiency
  • Purine metabolism
  • Purine metabolism
  • Purine Nucleoside Phosphorylase Deficiency
  • Thioguanine Action Pathway
  • Xanthine Dehydrogenase Deficiency (Xanthinuria)
  • Xanthinuria type I
  • Xanthinuria type II
Reactions
Inosinic acid + Ammonia + NADP → Guanosine monophosphate + NADPH details
Inosinic acid + Ammonia + NADP → Guanosine monophosphate + NADPH + Hydrogen Ion details
GO Classification
Biological Process
purine nucleobase metabolic process
nucleotide metabolic process
purine-containing compound salvage
response to cold
Cellular Component
cytosol
Function
catalytic activity
oxidoreductase activity, acting on nadh or nadph, nitrogenous group as acceptor
gmp reductase activity
oxidoreductase activity
oxidoreductase activity, acting on nadh or nadph
Molecular Function
metal ion binding
GMP reductase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p23
SNPs GMPR
Gene Sequence
>1038 bp
ATGCCCCGCATAGATGCGGACCTCAAGCTCGACTTCAAGGATGTCCTGCTCCGACCTAAG
CGGAGCAGCCTCAAGAGCCGAGCCGAGGTGGATCTTGAACGCACCTTCACGTTTCGAAAT
TCAAAGCAGACCTACTCAGGGATTCCCATCATCGTGGCCAACATGGACACTGTGGGCACG
TTTGAGATGGCAGCCGTGATGTCACAGCACTCCATGTTTACAGCAATTCATAAGCATTAC
TCCCTGGATGACTGGAAGCTCTTTGCCACAAATCACCCAGAATGCCTGCAGAATGTAGCC
GTGAGTTCAGGCAGTGGGCAGAATGATCTGGAAAAGATGACCAGCATCCTGGAAGCTGTG
CCACAGGTTAAGTTTATTTGCCTGGATGTGGCCAATGGGTATTCAGAACATTTTGTGGAA
TTCGTGAAACTTGTCCGTGCCAAATTTCCTGAACACACCATTATGGCAGGGAACGTGGTG
ACAGGAGAAATGGTAGAAGAGCTTATTCTTTCCGGAGCAGATATCATCAAAGTGGGAGTT
GGACCAGGTTCTGTGTGCACCACCCGCACCAAGACGGGAGTGGGGTACCCCCAGCTGAGT
GCCGTCATTGAGTGTGCCGACTCTGCCCATGGCCTGAAGGGCCACATCATCTCTGATGGA
GGCTGTACGTGTCCAGGGGATGTCGCCAAAGCCTTTGGAGCTGGAGCAGATTTTGTCATG
CTGGGAGGAATGTTTTCGGGTCATACGGAGTGTGCTGGAGAAGTGTTTGAGAGGAACGGA
CGGAAGCTCAAGCTCTTCTACGGGATGAGCTCTGACACCGCCATGAACAAGCACGCAGGA
GGAGTTGCTGAGTACAGAGCCTCTGAGGGTAAGACTGTGGAAGTTCCTTACAAAGGAGAT
GTGGAAAACACTATCCTGGATATTCTCGGGGGACTGAGGTCCACGTGCACCTACGTGGGG
GCCGCCAAACTCAAGGAGCTCAGCAGGAGGGCAACATTCATCCGGGTGACCCAGCAGCAC
AACACCGTGTTCAGCTAA
Protein Properties
Number of Residues 345
Molecular Weight 37418.58
Theoretical pI 7.068
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>GMP reductase 1
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT
FEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
PQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGV
GPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM
LGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD
VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
GenBank ID Protein 56001065
UniProtKB/Swiss-Prot ID P36959
UniProtKB/Swiss-Prot Entry Name GMPR1_HUMAN
PDB IDs
GenBank Gene ID AL009031
GeneCard ID GMPR
GenAtlas ID GMPR
HGNC ID HGNC:4376
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Kanno H, Huang IY, Kan YW, Yoshida A: Two structural genes on different chromosomes are required for encoding the major subunit of human red cell glucose-6-phosphate dehydrogenase. Cell. 1989 Aug 11;58(3):595-606. [PubMed:2758468 ]
  4. Kondoh T, Kanno H, Chang L, Yoshida A: Genomic structure and expression of human guanosine monophosphate reductase. Hum Genet. 1991 Dec;88(2):219-24. [PubMed:1661705 ]
  5. Henikoff S, Smith JM: The human mRNA that provides the N-terminus of chimeric G6PD encodes GMP reductase. Cell. 1989 Sep 22;58(6):1021-2. [PubMed:2570640 ]
  6. Yoshida A, Kan YW: Origin of "fused" glucose-6-phosphate dehydrogenase. Cell. 1990 Jul 13;62(1):11-2. [PubMed:1694726 ]
  7. Kondoh T, Kanno H, Chang LF, Yoshida A: Identification of common variant alleles of the human guanosine monophosphate reductase gene. Hum Genet. 1991 Dec;88(2):225-7. [PubMed:1757097 ]