You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00715
Secondary Accession Numbers
  • 5989
Name Carbohydrate sulfotransferase 7
Synonyms
  1. C6ST-2
  2. Chondroitin 6-sulfotransferase 2
  3. GST-5
  4. Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 5
  5. GlcNAc6ST-4
  6. Gn6st-4
  7. N-acetylglucosamine 6-O-sulfotransferase 4
Gene Name CHST7
Protein Type Enzyme
Biological Properties
General Function Involved in sulfotransferase activity
Specific Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues. Preferentially acts on mannose-linked GlcNAc. Also able to catalyze the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Also acts on core 2 mucin-type oligosaccharide and N-acetyllactosamine oligomer with a lower efficiency. Has weak or no activity toward keratan sulfate and oligosaccharides containing the Galbeta1-4GlcNAc. Catalyzes 6-O-sulfation of beta-benzyl GlcNAc but not alpha- or beta-benzyl GalNAc.
Pathways
  • Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Reactions
Phosphoadenosine phosphosulfate + Chondroitin → Adenosine 3',5'-diphosphate + Chondroitin 6-sulfate details
GO Classification
Biological Process
chondroitin sulfate biosynthetic process
polysaccharide metabolic process
N-acetylglucosamine metabolic process
Cellular Component
integral to membrane
Golgi membrane
Component
golgi membrane
membrane
cell part
organelle membrane
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfotransferase activity
Molecular Function
chondroitin 6-sulfotransferase activity
N-acetylglucosamine 6-O-sulfotransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location X
Locus Xp11.23
SNPs CHST7
Gene Sequence
>1461 bp
ATGAAGGGCCGGCGGCGGCGACGCCGAGAGTACTGCAAGTTCGCGCTGCTGTTGGTGCTG
TACACGCTGGTGCTGTTGCTCGTCCCCTCCGTATTGGACGGCGGCCGCGACGGGGACAAG
GGCGCCGAGCACTGCCCCGGCCTGCAGCGCAGCCTGGGAGTGTGGAGCCTGGAGGCGGCG
GCGGCCGGCGAACGCGAGCAGGGAGCGGAGGCGCGGGCCGCCGAGGAAGGGGGCGCGAAC
CAGTCTCCTCGGTTCCCAAGCAACCTCAGCGGCGCTGTCGGGGAGGCAGTGTCTCGCGAG
AAGCAGCACATCTACGTGCATGCCACCTGGCGCACCGGCTCGTCCTTCCTGGGCGAACTC
TTTAACCAGCACCCGGACGTTTTCTACTTGTATGAGCCCATGTGGCATCTATGGCAGGCG
CTGTATCCGGGCGACGCCGAGAGCTTGCAGGGCGCGCTGCGCGACATGCTGCGTTCGCTC
TTCCGCTGCGACTTCTCCGTGCTGCGGCTGTACGCGCCGCCGGGGGACCCCGCTGCGCGC
GCCCCGGACACGGCCAATCTTACCACGGCCGCCCTCTTCCGCTGGCGGACTAACAAGGTC
ATCTGCTCGCCGCCACTGTGTCCTGGCGCACCCCGTGCCCGGGCCGAGGTGGGCCTCGTC
GAGGACACCGCCTGCGAGCGCAGCTGCCCACCCGTGGCGATACGCGCCCTGGAGGCCGAG
TGCCGAAAGTACCCGGTGGTGGTCATCAAGGACGTGCGCCTGCTCGATCTGGGCGTGCTG
GTGCCCCTGTTGCGTGATCCAGGCCTCAACCTGAAGGTGGTGCAGCTTTTCCGCGACCCG
AGGGCGGTGCACAACTCGCGCCTCAAGTCTAGGCAGGGACTGCTGCGCGAGAGCATCCAG
GTGCTGCGCACCCGCCAGAGGGGCGACCGCTTCCACCGTGTGCTGCTGGCGCACGGCGTG
GGTGCTCGCCCCGGGGGCCAGTCTCGCGCGCTGCCCGCCGCGCCGCGCGCCGATTTCTTC
CTGACCGGTGCGCTCGAGGTGATCTGCGAAGCCTGGCTGCGCGATCTGCTTTTCGCGCGC
GGCGCGCCCGCCTGGCTGCGGCGCCGCTACCTGAGGCTGCGCTATGAGGACCTGGTGCGG
CAGCCACGCGCCCAGCTGCGCCGCCTGCTGCGCTTCTCCGGGCTACGCGCGCTCGCAGCG
CTCGATGCCTTCGCGCTCAACATGACTCGCGGCGCGGCCTACGGCGCCGACCGGCCCTTC
CACCTGTCAGCGCGCGACGCCCGGGAGGCGGTGCACGCCTGGCGCGAGCGCCTGAGCCGA
GAGCAGGTGCGCCAGGTGGAGGTCGCCTGCGCTCCAGCCATGCGTCTGCTCGCCTACCCT
CGCAGCGGAGAGGAGGGCGACGCGGAGCAGCCCAGGGAAGGGGAGACGCCGCTGGAGATG
GATGCCGACGGCGCCACGTAG
Protein Properties
Number of Residues 486
Molecular Weight 54265.635
Theoretical pI 9.644
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carbohydrate sulfotransferase 7
MKGRRRRRREYCKFALLLVLYTLVLLLVPSVLDGGRDGDKGAEHCPGLQRSLGVWSLEAA
AAGEREQGAEARAAEEGGANQSPRFPSNLSGAVGEAVSREKQHIYVHATWRTGSSFLGEL
FNQHPDVFYLYEPMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAAR
APDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAE
CRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQ
VLRTRQRGDRFHRVLLAHGVGARPGGQSRALPAAPRADFFLTGALEVICEAWLRDLLFAR
GAPAWLRRRYLRLRYEDLVRQPRAQLRRLLRFSGLRALAALDAFALNMTRGAAYGADRPF
HLSARDAREAVHAWRERLSREQVRQVEAACAPAMRLLAYPRSGEEGDAEQPREGETPLEM
DADGAT
GenBank ID Protein 9309344
UniProtKB/Swiss-Prot ID Q9NS84
UniProtKB/Swiss-Prot Entry Name CHST7_HUMAN
PDB IDs Not Available
GenBank Gene ID AB037187
GeneCard ID CHST7
GenAtlas ID CHST7
HGNC ID HGNC:13817
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  3. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  4. Uchimura K, Fasakhany F, Kadomatsu K, Matsukawa T, Yamakawa T, Kurosawa N, Muramatsu T: Diversity of N-acetylglucosamine-6-O-sulfotransferases: molecular cloning of a novel enzyme with different distribution and specificities. Biochem Biophys Res Commun. 2000 Aug 2;274(2):291-6. [PubMed:10913333 ]
  5. Kitagawa H, Fujita M, Ito N, Sugahara K: Molecular cloning and expression of a novel chondroitin 6-O-sulfotransferase. J Biol Chem. 2000 Jul 14;275(28):21075-80. [PubMed:10781596 ]
  6. Bhakta S, Bartes A, Bowman KG, Kao WM, Polsky I, Lee JK, Cook BN, Bruehl RE, Rosen SD, Bertozzi CR, Hemmerich S: Sulfation of N-acetylglucosamine by chondroitin 6-sulfotransferase 2 (GST-5). J Biol Chem. 2000 Dec 22;275(51):40226-34. [PubMed:10956661 ]