You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00738
Secondary Accession Numbers
  • 6013
Name Ethanolamine-phosphate cytidylyltransferase
Synonyms
  1. CTP:phosphoethanolamine cytidylyltransferase
  2. Phosphorylethanolamine transferase
Gene Name PCYT2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. Catalyzes the formation of CDP-ethanolamine.
Pathways
  • Glycerophospholipid metabolism
  • Lamivudine Metabolism Pathway
  • Phosphatidylcholine Biosynthesis
  • Phosphatidylcholine Biosynthesis PC(11D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(9D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9M5)
  • phosphatidylethanolamine biosynthesis
  • Phosphatidylethanolamine Biosynthesis
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9M5)
Reactions
Cytidine triphosphate + O-Phosphoethanolamine → Pyrophosphate + CDP-ethanolamine details
Cytidine triphosphate + Ciliatine → Pyrophosphate + CMP-2-aminoethylphosphonate details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylethanolamine biosynthetic process
biosynthetic process
Cellular Component
endoplasmic reticulum membrane
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
Molecular Function
nucleotidyltransferase activity
ethanolamine-phosphate cytidylyltransferase activity
Process
metabolic process
biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.3
SNPs PCYT2
Gene Sequence
>1170 bp
ATGATCCGGAACGGGCGCGGGGCTGCAGGCGGCGCAGAGCAGCCGGGCCCGGGGGGCAGG
CGCGCCGTGAGGGTGTGGTGCGATGGCTGCTATGACATGGTGCATTACGGCCACTCCAAC
CAGCTGCGCCAGGCACGGGCCATGGGTGACTACCTCATCGTAGGCGTGCACACCGATGAG
GAGATCGCCAAGCACAAGGGGCCCCCGGTGTTCACTCAGGAGGAGAGATACAAGATGGTG
CAGGCCATCAAATGGGTGGACGAGGTGGTGCCAGCGGCTCCCTACGTCACTACACTAGAG
ACCCTGGACAAATACAACTGTGACTTCTGTGTTCACGGCAATGACATCACCCTGACTGTA
GATGGCCGGGACACCTATGAGGAAGTAAAGCAGGCTGGGAGGTACAGAGAATGCAAGCGC
ACGCAAGGGGTGTCCACCACAGACCTCGTGGGCCGCATGCTGCTGGTAACCAAAGCCCAT
CACAGCAGCCAGGAGATGTCCTCTGAGTACCGGGAGTATGCAGACAGTTTTGGCAAGTGC
CCTGGTGGGCGGAACCCCTGGACCGGGGTATCCCAGTTCCTGCAGACATCTCAGAAGATC
ATCCAGTTTGCTTCTGGGAAGGAGCCCCAGCCAGGGGAGACAGTCATCTATGTGGCTGGT
GCCTTCGACCTGTTCCACATCGGGCATGTGGACTTCCTGGAGAAGGTGCACAGGCTGGCA
GAGAGGCCCTACATCATCGCGGGCTTACACTTTGACCAGGAGGTCAATCACTACAAGGGG
AAGAACTACCCCATCATGAATCTGCATGAACGGACTCTGAGCGTGCTGGCCTGCCGGTAC
GTGTCAGAAGTGGTGATTGGAGCCCCGTACGCGGTCACAGCAGAGCTCCTAAGTCACTTC
AAGGTGGACCTGGTGTGTCACGGCAAGACAGAAATTATCCCTGACAGGGATGGCTCCGAC
CCATACCAGGAGCCCAAGAGAAGGGGCATCTTCCGTCAGATTGACAGTGGCAGCAACCTC
ACCACAGACCTCATCGTCCAGCGGATCATCACCAACAGGTTGGAGTATGAGGCGCGAAAC
CAGAAGAAGGAAGCCAAGGAGCTGGCCTTCCTGGAGGCTGCCAGGCAGCAGGCGGCACAG
CCCCTGGGGGAGCGCGATGGTGACTTCTAA
Protein Properties
Number of Residues 389
Molecular Weight 35199.52
Theoretical pI 6.465
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ethanolamine-phosphate cytidylyltransferase
MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDE
EIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTV
DGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKC
PGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLA
ERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHF
KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARN
QKKEAKELAFLEAARQQAAQPLGERDGDF
GenBank ID Protein 12653167
UniProtKB/Swiss-Prot ID Q99447
UniProtKB/Swiss-Prot Entry Name PCY2_HUMAN
PDB IDs
GenBank Gene ID BC000351
GeneCard ID PCYT2
GenAtlas ID PCYT2
HGNC ID HGNC:8756
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nakashima A, Hosaka K, Nikawa J: Cloning of a human cDNA for CTP-phosphoethanolamine cytidylyltransferase by complementation in vivo of a yeast mutant. J Biol Chem. 1997 Apr 4;272(14):9567-72. [PubMed:9083101 ]