You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00798
Secondary Accession Numbers
  • 6078
Name 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4
Synonyms
  1. 6-phosphofructo-2-kinase
  2. 6PF-2-K/Fru-2,6-P2ase 4
  3. 6PF-2-K/Fru-2,6-P2ase testis-type isozyme
  4. Fructose-2,6-bisphosphatase
  5. PFK/FBPase 4
Gene Name PFKFB4
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Synthesis and degradation of fructose 2,6-bisphosphate.
Pathways
  • Fructose and mannose metabolism
  • HIF-1 signaling pathway
Reactions
D-Fructose 2,6-bisphosphate + Water → Fructose 6-phosphate + Phosphate details
Adenosine triphosphate + Fructose 6-phosphate → ADP + D-Fructose 2,6-bisphosphate details
D-Fructose 2,6-bisphosphate + Water → Beta-D-Fructose 6-phosphate + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
fructose metabolic process
glycolysis
fructose 2,6-bisphosphate metabolic process
Cellular Component
cytosol
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphotransferase activity, alcohol group as acceptor
phosphofructokinase activity
6-phosphofructo-2-kinase activity
Molecular Function
ATP binding
fructose-2,6-bisphosphate 2-phosphatase activity
6-phosphofructo-2-kinase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3p22-p21
SNPs PFKFB4
Gene Sequence
>1410 bp
ATGGCGTCCCCACGGGAATTGACACAGAACCCCCTGAAGAAGATCTGGATGCCATACAGC
AATGGGCGGCCCGCTCTGCACGCTTGCCAGCGCGGTGTGTGCATGACCAACTGCCCAACT
CTCATTGTCATGGTGGGCCTGCCCGCCAGGGGCAAGACCTACATCTCCAAGAAGCTGACT
CGATACCTGAACTGGATTGGTGTGCCCACTCGGGAGTTCAATGTTGGCCAGTACCGCCGG
GACGTGGTCAAGACCTACAAATCTTTTGAATTTTTTCTCCCCGACAATGAAGAGGGCCTG
AAAATCAGGAAGCAGTGTGCCCTGGCAGCCCTCCGTGACGTCCGGCGGTTCCTTAGTGAG
GAGGGGGGACATGTGGCGGTTTTTGATGCCACAAACACCACCCGAGAACGGAGAGCGACC
ATCTTTAATTTTGGAGAACAGAATGGCTACAAGACCTTTTTTGTCGAGTCCATCTGTGTG
GATCCTGAGGTCATAGCTGCCAACATCGTGCAAGTGAAACTGGGCAGCCCTGACTATGTC
AACCGCGACAGTGATGAGGCTACGGAGGACTTCATGAGGCGCATTGAGTGCTATGAGAAC
TCCTACGAGTCGCTAGATGAGGACCTGGATAGGGACCTGTCCTATATCAAGATCATGGAT
GTGGGCCAGAGCTACGTGGTGAACCGTGTGGCTGACCACATCCAGAGCCGCATCGTATAT
TACCTCATGAACATCCACGTGACCCCCCGCTCCATCTACCTCTGCCGGCACGGGGAGAGC
GAGCTCAACCTCAAGGGCCGGATTGGCGGGGACCCAGGACTGTCCCCTCGGGGCAGGGAG
TTTGCCAAGAGTCTAGCCCAGTTCATCAGTGACCAAAATATCAAGGATCTGAAGGTCTGG
ACAAGCCAGATGAAGAGGACAATCCAGACGGCTGAGGCACTGGGTGTGCCCTATGAACAG
TGGAAGGTCCTCAACGAGATCGATGCGGGCGTCTGTGAGGAAATGACCTACGAGGAAATT
CAGGATAATTATCCACTGGAGTTCGCCCTGCGGGACCAGGACAAGTACCGGTACCGGTAC
CCTAAAGGGGAGTCCTACGAGGACCTGGTCCAGAGACTGGAGCCTGTCATCATGGAGCTG
GAGAGGCAAGAGAATGTGCTGGTCATCTGCCACCAGGCTGTGATGCGCTGCCTGCTGGCC
TACTTCCTCGACAAGGCAGCAGAACAGCTGCCCTACCTCAAGTGTCCGCTGCACACAGTC
CTGAAGCTGACTCCTGTGGCATATGGTTGTAAAGTGGAGTCCATATTCCTGAACGTGGCT
GCTGTGAACACGCACCGGGACAGGCCTCAGAACGTGGACATCTCAAGACCTCCAGAGGAA
GCCCTTGTCACGGTGCCTGCTCACCAGTGA
Protein Properties
Number of Residues 469
Molecular Weight 54039.34
Theoretical pI 6.628
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSE
EGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVW
TSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q16877
UniProtKB/Swiss-Prot Entry Name F264_HUMAN
PDB IDs Not Available
GenBank Gene ID D49818
GeneCard ID PFKFB4
GenAtlas ID PFKFB4
HGNC ID HGNC:8875
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Sakai A, Kato M, Fukasawa M, Ishiguro M, Furuya E, Sakakibara R: Cloning of cDNA encoding for a novel isozyme of fructose 6-phosphate, 2-kinase/fructose 2,6-bisphosphatase from human placenta. J Biochem. 1996 Mar;119(3):506-11. [PubMed:8830046 ]
  4. Manzano A, Perez JX, Nadal M, Estivill X, Lange A, Bartrons R: Cloning, expression and chromosomal localization of a human testis 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase gene. Gene. 1999 Mar 18;229(1-2):83-9. [PubMed:10095107 ]
  5. Gomez M, Manzano A, Navarro-Sabate A, Duran J, Obach M, Perales JC, Bartrons R: Specific expression of pfkfb4 gene in spermatogonia germ cells and analysis of its 5'-flanking region. FEBS Lett. 2005 Jan 17;579(2):357-62. [PubMed:15642344 ]