You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00802
Secondary Accession Numbers
  • 6082
Name Transaldolase
Synonyms Not Available
Gene Name TALDO1
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Pathways
  • Glucose-6-phosphate dehydrogenase deficiency
  • Pentose Phosphate Pathway
  • Pentose phosphate pathway
  • Ribose-5-phosphate isomerase deficiency
  • Transaldolase deficiency
  • Warburg Effect
Reactions
D-Sedoheptulose 7-phosphate + Glyceraldehyde 3-phosphate → D-Erythrose 4-phosphate + Fructose 6-phosphate details
D-Sedoheptulose 7-phosphate + Glyceraldehyde 3-phosphate → D-Erythrose 4-phosphate + Beta-D-Fructose 6-phosphate details
GO Classification
Biological Process
pentose-phosphate shunt, non-oxidative branch
pentose-phosphate shunt
fructose 6-phosphate metabolic process
energy reserve metabolic process
glyceraldehyde-3-phosphate metabolic process
xylulose biosynthetic process
Cellular Component
cytosol
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
transferase activity
transferase activity, transferring aldehyde or ketonic groups
transaldolase activity
Molecular Function
monosaccharide binding
sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity
Process
metabolic process
primary metabolic process
pentose-phosphate shunt
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location 11
Locus 11p15.5-p15.4
SNPs TALDO1
Gene Sequence
>1014 bp
ATGTCGAGCTCACCCGTGAAGCGTCAGAGGATGGAGTCCGCGCTGGACCAGCTCAAGCAG
TTCACCACCGTGGTGGCCGACACGGGCGACTTCCACGCCATCGACGAGTACAAGCCCCAG
GATGCTACCACCAACCCGTCCCTGATCCTGGCCGCAGCACAGATGCCCGCTTACCAGGAG
CTGGTGGAGGAGGCGATTGCCTATGGCCGGAAGCTGGGCGGGTCACAAGAGGACCAGATT
AAAAATGCTATTGATAAACTTTTTGTGTTGTTTGGAGCAGAAATACTAAAGAAGATTCCG
GGCCGAGTATCCACAGAAGTAGACGCAAGGCTCTCCTTTGATAAAGATGCGATGGTGGCC
AGAGCCAGGCGGCTCATCGAGCTCTACAAGGAAGCTGGGATCAGCAAGGACCGAATTCTT
ATAAAGCTGTCATCAACCTGGGAAGGAATTCAGGCTGGAAAGGAGCTCGAGGAGCAGCAC
GGCATCCACTGCAACATGACGTTACTCTTCTCCTTCGCCCAGGCTGTGGCCTGTGCCGAG
GCGGGTGTGACCCTCATCTCCCCATTTGTTGGGCGCATCCTTGATTGGCATGTGGCAAAC
ACCGACAAGAAATCCTATGAGCCCCTGGAAGACCCTGGGGTAAAGAGTGTCACTAAAATC
TACAACTACTACAAGAAGTTTAGCTACAAAACCATTGTCATGGGCGCCTCCTTCCGCAAC
ACGGGCGAGATCAAAGCACTGGCCGGCTGTGACTTCCTCACCATCTCACCCAAGCTCCTG
GGAGAGCTGCTGCAGGACAACGCCAAGCTGGTGCCTGTGCTCTCAGCCAAGGCGGCCCAA
GCCAGTGACCTGGAAAAAATCCACCTGGATGAGAAGTCTTTCCGTTGGTTGCACAACGAG
GACCAGATGGCTGTGGAGAAGCTCTCTGACGGGATCCGCAAGTTTGCCGCTGATGCAGTG
AAGCTGGAGCGGATGCTGACAGAACGAATGTTCAATGCAGAGAATGGAAAGTAG
Protein Properties
Number of Residues 337
Molecular Weight 37539.74
Theoretical pI 6.812
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Transaldolase
MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQE
LVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVA
RARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAE
AGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRN
TGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNE
DQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK
GenBank ID Protein 2612879
UniProtKB/Swiss-Prot ID P37837
UniProtKB/Swiss-Prot Entry Name TALDO_HUMAN
PDB IDs
GenBank Gene ID AF010400
GeneCard ID TALDO1
GenAtlas ID TALDO1
HGNC ID HGNC:11559
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Banki K, Halladay D, Perl A: Cloning and expression of the human gene for transaldolase. A novel highly repetitive element constitutes an integral part of the coding sequence. J Biol Chem. 1994 Jan 28;269(4):2847-51. [PubMed:8300619 ]
  7. Banki K, Eddy RL, Shows TB, Halladay DL, Bullrich F, Croce CM, Jurecic V, Baldini A, Perl A: The human transaldolase gene (TALDO1) is located on chromosome 11 at p15.4-p15.5. Genomics. 1997 Oct 1;45(1):233-8. [PubMed:9339383 ]
  8. Kusuda J, Hirai M, Toyoda A, Tanuma R, Nomura-Kitabayashi A, Hashimoto K: Cloning and chromosomal localization of a paralog and a mouse homolog of the human transaldolase gene. Gene. 1998 Mar 16;209(1-2):13-21. [PubMed:9524206 ]
  9. Perl A, Colombo E, Samoilova E, Butler MC, Banki K: Human transaldolase-associated repetitive elements are transcribed by RNA polymerase III. J Biol Chem. 2000 Mar 10;275(10):7261-72. [PubMed:10702296 ]
  10. Verhoeven NM, Huck JH, Roos B, Struys EA, Salomons GS, Douwes AC, van der Knaap MS, Jakobs C: Transaldolase deficiency: liver cirrhosis associated with a new inborn error in the pentose phosphate pathway. Am J Hum Genet. 2001 May;68(5):1086-92. Epub 2001 Mar 27. [PubMed:11283793 ]