You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00834
Secondary Accession Numbers
  • 6115
Name Glutathione S-transferase P
Synonyms
  1. GST class-pi
  2. GSTP1-1
Gene Name GSTP1
Protein Type Enzyme
Biological Properties
General Function Involved in glutathione transferase activity
Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Pathways
  • Acetaminophen Metabolism Pathway
  • Chemical carcinogenesis
  • Drug metabolism - cytochrome P450
  • Glutathione metabolism
  • Metabolism of xenobiotics by cytochrome P450
  • Prostate cancer
Reactions
RX + Glutathione → HX + R-S-glutathione details
RX + Glutathione → Halide + R-S-Glutathione details
Naphthalene epoxide + Glutathione → (1R)-Hydroxy-(2R)-glutathionyl-1,2-dihydronaphthalene details
(1S,2R)-Naphthalene 1,2-oxide + Glutathione → (1R)-Glutathionyl-(2R)-hydroxy-1,2-dihydronaphthalene details
(1S,2R)-Naphthalene 1,2-oxide + Glutathione → (1S)-Hydroxy-(2S)-glutathionyl-1,2-dihydronaphthalene details
1-Nitronaphthalene-7,8-oxide + Glutathione → 1-Nitro-7-hydroxy-8-glutathionyl-7,8-dihydronaphthalene details
1-Nitronaphthalene-7,8-oxide + Glutathione → 1-Nitro-7-glutathionyl-8-hydroxy-7,8-dihydronaphthalene details
1-Nitronaphthalene-5,6-oxide + Glutathione → 1-Nitro-5-hydroxy-6-glutathionyl-5,6-dihydronaphthalene details
1-Nitronaphthalene-5,6-oxide + Glutathione → 1-Nitro-5-glutathionyl-6-hydroxy-5,6-dihydronaphthalene details
Bromobenzene-3,4-oxide + Glutathione → 3,4-Dihydro-3-hydroxy-4-S-glutathionyl bromobenzene details
Bromobenzene-2,3-oxide + Glutathione → 2,3-Dihydro-2-S-glutathionyl-3-hydroxy bromobenzene details
Benzo[a]pyrene-4,5-oxide + Glutathione → 4,5-Dihydro-4-hydroxy-5-S-glutathionyl-benzo[a]pyrene details
Benzo[a]pyrene-7,8-diol + Glutathione → 7,8-Dihydro-7-hydroxy-8-S-glutathionyl-benzo[a]pyrene + Water details
2,2-Dichloroacetaldehyde + Glutathione → S-(2,2-Dichloro-1-hydroxy)ethyl glutathione details
1,1-Dichloroethylene epoxide + Glutathione → 2-(S-Glutathionyl)acetyl chloride + Hydrochloric acid details
Chloroacetyl chloride + Glutathione → S-(2-Chloroacetyl)glutathione + Hydrochloric acid details
2-(S-Glutathionyl)acetyl chloride + Glutathione → 2-(S-Glutathionyl)acetyl glutathione + Hydrochloric acid details
Trichloroethylene + Glutathione → S-(1,2-Dichlorovinyl)glutathione + Hydrochloric acid details
1,2-Dibromoethane + Glutathione + Hydrogen Ion → Glutathione episulfonium ion + Bromide details
2-Bromoacetaldehyde + Glutathione → S-(Formylmethyl)glutathione + Bromide details
Aldophosphamide + Glutathione → 4-Glutathionyl cyclophosphamide + Water details
2,3-Epoxyaflatoxin B1 + Glutathione → Aflatoxin B1exo-8,9-epoxide-GSH details
3-(4-hydroxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-2-hydroxy-1-(4-hydroxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(4-hydroxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-hydroxy-2-(4-hydroxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
5-[3-(4-hydroxyphenyl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,5-dihydroxyphenyl)-2-hydroxy-1-(4-hydroxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[3-(4-hydroxyphenyl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,5-dihydroxyphenyl)-2-hydroxy-2-(4-hydroxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2Z)-3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-2-hydroxyprop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-2-hydroxy-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)oxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-1-hydroxy-3-oxopropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4,5-dihydroxy-2,3-dimethoxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(4,5-dihydroxy-2,3-dimethoxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
[3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)oxiran-2-yl]methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-1,3-dihydroxypropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
[3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)oxiran-2-yl]methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-2,3-dihydroxypropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-2-hydroxyethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-2-hydroxyethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
12,16-dimethoxy-5,7,9,21-tetraoxahexacyclo[11.8.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁵,²⁰]henicosa-1(13),2(10),11,15,17,19-hexaen-14-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({5-hydroxy-11,15-dimethoxy-13-oxo-6,8,20-trioxapentacyclo[10.8.0.0²,⁹.0³,⁷.0¹⁴,¹⁹]icosa-1(12),2(9),10,14,16,18-hexaen-4-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
dimethyloxirane-2-carboxylic acid → 2-amino-4-({2-[(1-carboxy-1-hydroxy-2-methylpropan-2-yl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-(3-acetyloxiran-2-yl)-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(7-methoxy-2-oxo-2H-chromen-6-yl)-3-oxobutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-(3-acetyloxiran-2-yl)-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(7-methoxy-2-oxo-2H-chromen-6-yl)-3-oxobutyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[3-(4-hydroxyphenyl)oxiran-2-yl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-{3,5-dihydroxy-4-[(1E)-3-methylbut-1-en-1-yl]phenyl}-2-hydroxy-1-(4-hydroxyphenyl)ethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[3-(4-hydroxyphenyl)oxiran-2-yl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{3,5-dihydroxy-4-[(1E)-3-methylbut-1-en-1-yl]phenyl}-2-hydroxy-2-(4-hydroxyphenyl)ethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-(4-hydroxyphenyl)ethenyl]-2-[3-(propan-2-yl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{2,6-dihydroxy-4-[(E)-2-(4-hydroxyphenyl)ethenyl]phenyl}-2-hydroxy-3-methylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-(4-hydroxyphenyl)ethenyl]-2-[3-(propan-2-yl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{2,6-dihydroxy-4-[(E)-2-(4-hydroxyphenyl)ethenyl]phenyl}-1-hydroxy-3-methylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[3-(3,4-dihydroxyphenyl)oxiran-2-yl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-{3,5-dihydroxy-4-[(1E)-3-methylbut-1-en-1-yl]phenyl}-1-(3,4-dihydroxyphenyl)-2-hydroxyethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[3-(3,4-dihydroxyphenyl)oxiran-2-yl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{3,5-dihydroxy-4-[(1E)-3-methylbut-1-en-1-yl]phenyl}-2-(3,4-dihydroxyphenyl)-2-hydroxyethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[3-(propan-2-yl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{4-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-2-hydroxy-3-methylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[3-(propan-2-yl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{4-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-1-hydroxy-3-methylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-(2-hydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl (2E)-2-methylbut-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{[8-(2-hydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl]oxy}-3-methyl-4-oxobutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-[2-(acetyloxy)-1-hydroxypropan-2-yl]-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl (2E)-2-methylbut-2-enoate → 4-[(2-{[4-({8-[2-(acetyloxy)-1-hydroxypropan-2-yl]-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl}oxy)-3-methyl-4-oxobutan-2-yl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]-2-aminobutanoic acid details
8-{2-[(2-hydroxyacetyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl (2E)-2-methylbut-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-[(8-{2-[(2-hydroxyacetyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl)oxy]-3-methyl-4-oxobutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-(1,2-dihydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl (2E)-2-methylbut-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{[8-(1,2-dihydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl]oxy}-3-methyl-4-oxobutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2,3-dimethyloxirane-2-carboxylic acid → 2-amino-4-({2-[(1-carboxy-2-hydroxy-1-methylpropyl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(R)-Oxypeucedanin → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-hydroxy-3-methyl-1-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)butan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(R)-Oxypeucedanin → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-hydroxy-2-methyl-4-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)butan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3,3-dimethyloxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(3-hydroxy-3-methyl-1-oxobutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3,3-dimethyloxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(3-hydroxy-2-methyl-4-oxobutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-{[3-(hydroxymethyl)-3-methyloxiran-2-yl]methoxy}-7H-furo[3,2-g]chromen-7-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3,4-dihydroxy-3-methyl-1-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)butan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-{[3-(hydroxymethyl)-3-methyloxiran-2-yl]methoxy}-7H-furo[3,2-g]chromen-7-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1,3-dihydroxy-2-methyl-4-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)butan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(2,4-dihydroxyphenyl)-5-hydroxy-8,8-dimethyl-3-{[3-methyl-3-(4-methylpent-3-en-1-yl)oxiran-2-yl]methyl}-4H,8H-pyrano[3,2-g]chromen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1-[2-(2,4-dihydroxyphenyl)-5-hydroxy-8,8-dimethyl-4-oxo-4H,8H-pyrano[3,2-g]chromen-3-yl]-3-hydroxy-3,7-dimethyloct-6-en-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(2,4-dihydroxyphenyl)-5-hydroxy-8,8-dimethyl-3-{[3-methyl-3-(4-methylpent-3-en-1-yl)oxiran-2-yl]methyl}-4H,8H-pyrano[3,2-g]chromen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1-[2-(2,4-dihydroxyphenyl)-5-hydroxy-8,8-dimethyl-4-oxo-4H,8H-pyrano[3,2-g]chromen-3-yl]-2-hydroxy-3,7-dimethyloct-6-en-3-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(2,4-dihydroxyphenyl)-3-[5-(3,3-dimethyloxiran-2-yl)-3-methylpent-2-en-1-yl]-5-hydroxy-8,8-dimethyl-4H,8H-pyrano[3,2-g]chromen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({8-[2-(2,4-dihydroxyphenyl)-5-hydroxy-8,8-dimethyl-4-oxo-4H,8H-pyrano[3,2-g]chromen-3-yl]-2-hydroxy-2,6-dimethyloct-6-en-3-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(2,4-dihydroxyphenyl)-3-[5-(3,3-dimethyloxiran-2-yl)-3-methylpent-2-en-1-yl]-5-hydroxy-8,8-dimethyl-4H,8H-pyrano[3,2-g]chromen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({8-[2-(2,4-dihydroxyphenyl)-5-hydroxy-8,8-dimethyl-4-oxo-4H,8H-pyrano[3,2-g]chromen-3-yl]-3-hydroxy-2,6-dimethyloct-6-en-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-(2,4-dihydroxyphenyl)-6-(3,7-dimethylocta-2,6-dien-1-yl)-9-hydroxy-14,14-dimethyl-4,12,15-trioxatetracyclo[8.5.0.0³,⁸.0¹¹,¹³]pentadeca-1(10),2,5,8-tetraen-7-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[8-(2,4-dihydroxyphenyl)-7-(3,7-dimethylocta-2,6-dien-1-yl)-4,5-dihydroxy-2,2-dimethyl-6-oxo-2H,3H,4H,6H-pyrano[3,2-g]chromen-3-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-(2,4-dihydroxyphenyl)-6-(3,7-dimethylocta-2,6-dien-1-yl)-9-hydroxy-14,14-dimethyl-4,12,15-trioxatetracyclo[8.5.0.0³,⁸.0¹¹,¹³]pentadeca-1(10),2,5,8-tetraen-7-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[8-(2,4-dihydroxyphenyl)-7-(3,7-dimethylocta-2,6-dien-1-yl)-3,5-dihydroxy-2,2-dimethyl-6-oxo-2H,3H,4H,6H-pyrano[3,2-g]chromen-4-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(3-ethyloxiran-2-yl)-1H-isochromen-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(1-oxo-1H-isochromen-3-yl)butyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(3-ethyloxiran-2-yl)-1H-isochromen-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(1-oxo-1H-isochromen-3-yl)butan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
10-(but-3-enoyl)-5,7-dihydroxy-8,8-dimethyl-4-propyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{3,5-dihydroxy-2,2-dimethyl-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-10-yl}-4-oxobutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-{6-[2-(oxiran-2-yl)propan-2-yl]-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl}propan-2-yl acetate → 4-({2-[(3-{2-[2-(acetyloxy)propan-2-yl]-7-oxo-2H,3H,7H-furo[3,2-g]chromen-6-yl}-1-hydroxy-3-methylbutan-2-yl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)-2-aminobutanoic acid details
2-(2-hydroxypropan-2-yl)-6-[2-(oxiran-2-yl)propan-2-yl]-2H,3H,7H-furo[3,2-g]chromen-7-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1-hydroxy-3-[2-(2-hydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-6-yl]-3-methylbutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-methoxy-4-[(3-phenyloxiran-2-yl)methyl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-3-(4-hydroxy-2-methoxyphenyl)-1-phenylpropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-methoxy-4-[(3-phenyloxiran-2-yl)methyl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-3-(4-hydroxy-2-methoxyphenyl)-1-phenylpropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(2-hydroxypropan-2-yl)oxiran-2-yl]-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1,3-dihydroxy-1-(7-methoxy-2-oxo-2H-chromen-6-yl)-3-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(2-hydroxypropan-2-yl)oxiran-2-yl]-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2,3-dihydroxy-1-(7-methoxy-2-oxo-2H-chromen-6-yl)-3-methylbutyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-methoxy-6-[7-methoxy-3-methyl-5-(3-methyloxiran-2-yl)-2,3-dihydro-1-benzofuran-2-yl]-2H-1,3-benzodioxole → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1-hydroxy-1-[7-methoxy-2-(7-methoxy-2H-1,3-benzodioxol-5-yl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]propan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-methoxy-6-[7-methoxy-3-methyl-5-(3-methyloxiran-2-yl)-2,3-dihydro-1-benzofuran-2-yl]-2H-1,3-benzodioxole → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({2-hydroxy-1-[7-methoxy-2-(7-methoxy-2H-1,3-benzodioxol-5-yl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]propyl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(3,5-dimethoxyphenyl)-3-phenyloxirane → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,5-dimethoxyphenyl)-2-hydroxy-1-phenylethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(3,5-dimethoxyphenyl)-3-phenyloxirane → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,5-dimethoxyphenyl)-2-hydroxy-2-phenylethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8,8-dimethyl-10-(3-methylbut-2-en-1-yl)-3-[2-(oxiran-2-yl)propan-2-yl]-2H,8H-pyrano[3,2-g]chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({3-[8,8-dimethyl-10-(3-methylbut-2-en-1-yl)-2-oxo-2H,8H-pyrano[3,2-g]chromen-3-yl]-1-hydroxy-3-methylbutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
10-[(3,3-dimethyloxiran-2-yl)methyl]-8,8-dimethyl-3-(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1-[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]-3-hydroxy-3-methylbutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
10-[(3,3-dimethyloxiran-2-yl)methyl]-8,8-dimethyl-3-(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]-3-hydroxy-2-methylbutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
14,14-dimethyl-2-(3-methylbut-2-en-1-yl)-6-(2-methylbut-3-en-2-yl)-4,12,15-trioxatetracyclo[8.5.0.0³,⁸.0¹¹,¹³]pentadeca-1(10),2,6,8-tetraen-5-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-hydroxy-2,2-dimethyl-10-(3-methylbut-2-en-1-yl)-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
14,14-dimethyl-2-(3-methylbut-2-en-1-yl)-6-(2-methylbut-3-en-2-yl)-4,12,15-trioxatetracyclo[8.5.0.0³,⁸.0¹¹,¹³]pentadeca-1(10),2,6,8-tetraen-5-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-hydroxy-2,2-dimethyl-10-(3-methylbut-2-en-1-yl)-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,3H,4H,8H-pyrano[3,2-g]chromen-4-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
7-methoxy-3-[2-(oxiran-2-yl)propan-2-yl]-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-3-(7-methoxy-2-oxo-2H-chromen-3-yl)-3-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-{[3-(4-hydroxy-3,3-dimethylbutyl)-3-methyloxiran-2-yl]methoxy}-7H-furo[3,2-g]chromen-7-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3,7-dihydroxy-3,6,6-trimethyl-1-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)heptan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-{[3-(4-hydroxy-3,3-dimethylbutyl)-3-methyloxiran-2-yl]methoxy}-7H-furo[3,2-g]chromen-7-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2,7-dihydroxy-3,6,6-trimethyl-1-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)heptan-3-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2,2-dimethyl-4-{2-methyl-3-[({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)methyl]oxiran-2-yl}butanoic acid → 6-({2-[(4-amino-4-carboxy-1-hydroxybutylidene)amino]-2-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}sulfanyl)-5-hydroxy-2,2,5-trimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)heptanoic acid details
2,2-dimethyl-4-{2-methyl-3-[({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)methyl]oxiran-2-yl}butanoic acid → 5-({2-[(4-amino-4-carboxy-1-hydroxybutylidene)amino]-2-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}sulfanyl)-6-hydroxy-2,2,5-trimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)heptanoic acid details
6-[3-(3,4-dimethoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,4-dimethoxyphenyl)-2-hydroxy-2-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(3,4-dimethoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,4-dimethoxyphenyl)-2-hydroxy-1-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
methyl (2Z)-2-hydroxy-3-(4-methoxyphenyl)prop-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-3-methoxy-1-(4-methoxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
methyl 3-(4-methoxyphenyl)oxirane-2-carboxylate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-3-methoxy-1-(4-methoxyphenyl)-3-oxopropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-methoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-2-hydroxy-1-(4-methoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(4-methoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-hydroxy-2-(4-methoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
6-[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-2-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-1-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
ethyl (2Z)-2-hydroxy-3-(4-methoxyphenyl)prop-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-ethoxy-2-hydroxy-1-(4-methoxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
ethyl 3-(4-methoxyphenyl)oxirane-2-carboxylate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-ethoxy-3-hydroxy-3-(4-methoxyphenyl)-1-oxopropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-9-(3-methylbutanoyl)-6-phenyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1,5,7,9-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[5,9-dihydroxy-8,8-dimethyl-6-(3-methylbutanoyl)-2-oxo-4-phenyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-9-(3-methylbutanoyl)-6-phenyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1,5,7,9-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[5,10-dihydroxy-8,8-dimethyl-6-(3-methylbutanoyl)-2-oxo-4-phenyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-6-phenyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),5,8-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({5,9-dihydroxy-8,8-dimethyl-2-oxo-4-phenyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-6-phenyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),5,8-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({5,10-dihydroxy-8,8-dimethyl-2-oxo-4-phenyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-6-methoxy-3,7-dioxabicyclo[4.1.0]heptan-2-one → 2-amino-4-{[2-({6-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-3-hydroxy-4-methoxy-2-oxooxan-4-yl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
4-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-6-methoxy-3,7-dioxabicyclo[4.1.0]heptan-2-one → 2-amino-4-{[2-({6-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-4-hydroxy-4-methoxy-2-oxooxan-3-yl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 2-methylbut-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-[(2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl)oxy]-3-methyl-4-oxobutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-hydroxy-2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propan-2-yl 2-methylbut-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{[1-hydroxy-2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propan-2-yl]oxy}-3-methyl-4-oxobutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-hydroxy-2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propan-2-yl 2-methylbut-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-[(8-{1-hydroxy-2-[(2-methylbut-2-enoyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl)oxy]-3-methyl-4-oxobutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2,3-dimethyloxirane-2-carboxylic acid → 2-amino-4-({2-[(1-carboxy-1-hydroxy-1-methylpropan-2-yl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-hydroxy-2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 2-methylbut-2-enoate → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-[(1-hydroxy-2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl)oxy]-3-methyl-4-oxobutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3,5-triol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-hydroxy-3-methyl-1-(2,4,6-trihydroxyphenyl)butan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3,5-triol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-hydroxy-2-methyl-4-(2,4,6-trihydroxyphenyl)butan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(R)-Meranzin → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-hydroxy-4-(7-methoxy-2-oxo-2H-chromen-8-yl)-2-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-{[3-(hydroxymethyl)-3-methyloxiran-2-yl]methyl}-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1,3-dihydroxy-4-(7-methoxy-2-oxo-2H-chromen-8-yl)-2-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-[3-(4-methoxyphenyl)oxiran-2-yl]-2-methylpropan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(4-methoxyphenyl)-4-methyl-3-oxopentan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-[3-(4-methoxyphenyl)oxiran-2-yl]-2-methylpropan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-methoxyphenyl)-4-methyl-3-oxopentyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-[3-(4-methoxyphenyl)oxiran-2-yl]propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-methoxyphenyl)-3-oxopentyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-[3-(4-methoxyphenyl)oxiran-2-yl]propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(4-methoxyphenyl)-3-oxopentan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2,4-dihydroxyphenyl)-3-hydroxy-3-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-(2,4-dihydroxyphenyl)-3-hydroxy-2-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-{3-[(3,3-dimethyloxiran-2-yl)methyl]-4-hydroxyphenyl}-2-hydroxypropanoic acid → 2-amino-4-{[2-({4-[5-(2-carboxy-2-hydroxyethyl)-2-hydroxyphenyl]-3-hydroxy-2-methylbutan-2-yl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
(2Z)-2-(hydroxymethyl)-3-phenylprop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(hydroxymethyl)-3-oxo-1-phenylpropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2Z)-3-(3-hydroxyphenyl)-2-methylprop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3-hydroxyphenyl)-2-methyl-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2Z)-3-(4-hydroxyphenyl)-2-methylprop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(4-hydroxyphenyl)-2-methyl-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-methyl-3-phenyloxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-2-methyl-3-oxo-1-phenylpropyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-methyl-3-phenyloxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-2-methyl-3-oxo-1-phenylpropan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2Z)-3-(2-hydroxyphenyl)-2-methylprop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2-hydroxyphenyl)-2-methyl-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-benzylprop-2-enal → 2-amino-4-({2-[(2-benzyl-3-oxopropyl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2-methyl-3-phenyloxiran-2-yl)methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2,3-dihydroxy-2-methyl-1-phenylpropyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2-methyl-3-phenyloxiran-2-yl)methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1,3-dihydroxy-2-methyl-1-phenylpropan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-methyl-3-phenyloxirane-2-carboxylic acid → 2-amino-4-({2-[(2-carboxy-2-hydroxy-2-methyl-1-phenylethyl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-methyl-3-phenyloxirane-2-carboxylic acid → 2-amino-4-({2-[(1-carboxy-2-hydroxy-1-methyl-2-phenylethyl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(2-methyl-3-phenyloxiran-2-yl)ethan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-2-methyl-3-oxo-1-phenylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(2-methyl-3-phenyloxiran-2-yl)ethan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-2-methyl-3-oxo-1-phenylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(3-phenyloxiran-2-yl)ethan-1-ol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2,3-dihydroxy-1-phenylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(3-phenyloxiran-2-yl)ethan-1-ol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1,3-dihydroxy-1-phenylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(3-phenyloxiran-2-yl)ethan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-3-oxo-1-phenylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(3-phenyloxiran-2-yl)ethan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-3-oxo-1-phenylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(1E)-5-phenyl-1-(3-phenyloxiran-2-yl)pent-1-en-3-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-5-oxo-1,7-diphenylhept-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(1E)-5-phenyl-1-(3-phenyloxiran-2-yl)pent-1-en-3-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-5-oxo-1,7-diphenylhept-3-en-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-phenyl-1-{3-[(E)-2-phenylethenyl]oxiran-2-yl}propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-hydroxy-5-oxo-1,7-diphenylhept-1-en-3-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-phenyl-1-{3-[(E)-2-phenylethenyl]oxiran-2-yl}propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[(1E)-3-hydroxy-5-oxo-1,7-diphenylhept-1-en-4-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-phenyl-5-(3-phenyloxiran-2-yl)pentan-3-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-5-oxo-1,7-diphenylheptyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-phenyl-5-(3-phenyloxiran-2-yl)pentan-3-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-5-oxo-1,7-diphenylheptan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2-hydroxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2-hydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2,3-dihydroxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2,3-dihydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2,5-dihydroxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2,5-dihydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2-hydroxyphenyl)oxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(2-hydroxyphenyl)-3-oxopropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2-hydroxyphenyl)oxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(2-hydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[3-(hydroxymethyl)oxiran-2-yl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1,3-dihydroxy-1-(2-hydroxyphenyl)propan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[3-(hydroxymethyl)oxiran-2-yl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2,3-dihydroxy-1-(2-hydroxyphenyl)propyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2-hydroxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-hydroxy-2-(2-hydroxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(2-hydroxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-2-hydroxy-1-(2-hydroxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
5-[3-(3-hydroxy-4-methoxyphenyl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,5-dihydroxyphenyl)-2-hydroxy-2-(3-hydroxy-4-methoxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[3-(3-hydroxy-4-methoxyphenyl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,5-dihydroxyphenyl)-2-hydroxy-1-(3-hydroxy-4-methoxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-phenyl-1-[3-(2-phenylethyl)oxiran-2-yl]propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-hydroxy-5-oxo-1,7-diphenylheptan-3-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-phenyl-1-[3-(2-phenylethyl)oxiran-2-yl]propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(3-hydroxy-5-oxo-1,7-diphenylheptan-4-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3,8-dihydroxy-7-(4-hydroxy-3,5-dimethoxyphenyl)-12-(4-hydroxyphenyl)-6λ⁴,11,13-trioxatetracyclo[7.4.1.0⁵,¹⁴.0¹⁰,¹²]tetradeca-1,3,5(14),6,8-pentaen-6-ylium → 7-({2-[(4-amino-4-carboxy-1-hydroxybutylidene)amino]-2-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}sulfanyl)-4,6,11-trihydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)-7-(4-hydroxyphenyl)-2λ⁴,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1(13),2,4,9,11-pentaen-2-ylium details
3,8-dihydroxy-7-(4-hydroxy-3,5-dimethoxyphenyl)-12-(4-hydroxyphenyl)-6λ⁴,11,13-trioxatetracyclo[7.4.1.0⁵,¹⁴.0¹⁰,¹²]tetradeca-1,3,5(14),6,8-pentaen-6-ylium → 6-({2-[(4-amino-4-carboxy-1-hydroxybutylidene)amino]-2-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}sulfanyl)-4,7,11-trihydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)-7-(4-hydroxyphenyl)-2λ⁴,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1(13),2,4,9,11-pentaen-2-ylium details
2-methoxy-4-[(oxiran-2-yl)methyl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2Z)-2-hydroxy-3-phenylprop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-3-oxo-1-phenylpropyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(E)-3-(4-Hydroxyphenyl)-2-propenal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(4-hydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2E)-3-(3-hydroxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3-hydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-phenyloxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-3-oxo-1-phenylpropan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(3-phenyloxiran-2-yl)methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2,3-dihydroxy-1-phenylpropyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(3-phenyloxiran-2-yl)methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1,3-dihydroxy-1-phenylpropan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-phenyloxirane-2-carboxylic acid → 2-amino-4-({2-[(2-carboxy-2-hydroxy-1-phenylethyl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-phenyloxirane-2-carboxylic acid → 2-amino-4-({2-[(1-carboxy-2-hydroxy-2-phenylethyl)sulfanyl]-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)ethyl]oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,4-dimethoxyphenyl)-1-{[2-(3,4-dimethoxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-2-hydroxyethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)ethyl]oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,4-dimethoxyphenyl)-2-{[2-(3,4-dimethoxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-2-hydroxyethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-phenyl-2-(2-phenylethyl)oxirane → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-2,4-diphenylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(4-methoxybenzoyl)-3-phenyloxirane → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-3-(4-methoxyphenyl)-3-oxo-1-phenylpropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(4-methoxybenzoyl)-3-phenyloxirane → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-3-(4-methoxyphenyl)-3-oxo-1-phenylpropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-methoxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(4-methoxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
[3-(4-methoxyphenyl)oxiran-2-yl]methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1,3-dihydroxy-1-(4-methoxyphenyl)propan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
[3-(4-methoxyphenyl)oxiran-2-yl]methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2,3-dihydroxy-1-(4-methoxyphenyl)propyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2Z)-2-hydroxy-3-(4-methoxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-methoxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2-hydroxy-4-methoxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2-hydroxy-4-methoxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-methoxyphenyl)oxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(4-methoxyphenyl)-3-oxopropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]ethan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-oxobutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]ethan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-oxobutyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-(2-hydroxy-4-methoxyphenyl)-12,12-dimethyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),5,8-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[10-hydroxy-3-(2-hydroxy-4-methoxyphenyl)-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-(2-hydroxy-4-methoxyphenyl)-12,12-dimethyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),5,8-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[9-hydroxy-3-(2-hydroxy-4-methoxyphenyl)-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-(3-methoxyoxiran-2-yl)-7-methyl-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-2-methoxy-1-(7-methyl-2-oxo-2H-chromen-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-2-{[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-1-(4-hydroxyphenyl)ethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-1-{[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-2-(4-hydroxyphenyl)ethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-1-{[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-2-(4-hydroxy-3-methoxyphenyl)ethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-2-{[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-1-(4-hydroxy-3-methoxyphenyl)ethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]-2-methoxyphenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1,2-bis(4-hydroxy-3-methoxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(3,3-dimethyloxiran-2-yl)methoxy]-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({3-hydroxy-4-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2-methylbutan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-{[6-hydroxy-3-methyl-6-(2-methyloxiran-2-yl)hex-2-en-1-yl]oxy}-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1,3-dihydroxy-8-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2,6-dimethyloct-6-en-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-{[3-(3-hydroxy-4-methylpent-4-en-1-yl)-3-methyloxiran-2-yl]methoxy}-7-methoxy-2H-chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({2,6-dihydroxy-1-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-3,7-dimethyloct-7-en-3-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-methoxy-6-[3-(4-methoxyphenyl)oxiran-2-yl]-5,6-dihydro-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-2-(4-methoxy-6-oxo-3,6-dihydro-2H-pyran-2-yl)-1-(4-methoxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-methoxy-6-[3-(4-methoxyphenyl)oxiran-2-yl]-5,6-dihydro-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-methoxy-6-oxo-3,6-dihydro-2H-pyran-2-yl)-2-(4-methoxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-methoxy-6-[3-(4-methoxyphenyl)oxiran-2-yl]oxan-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-2-(4-methoxy-6-oxooxan-2-yl)-1-(4-methoxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-methoxy-6-[3-(4-methoxyphenyl)oxiran-2-yl]oxan-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-methoxy-6-oxooxan-2-yl)-2-(4-methoxyphenyl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(3-hydroxy-4-methoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(3-hydroxy-4-methoxyphenyl)-2-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(3-hydroxy-4-methoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-2-(3-hydroxy-4-methoxyphenyl)-1-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(2,4-dimethoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(2,4-dimethoxyphenyl)-2-hydroxy-1-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[3-(2,4-dimethoxyphenyl)oxiran-2-yl]-4-methoxy-2H-pyran-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2,4-dimethoxyphenyl)-2-hydroxy-2-(4-methoxy-2-oxo-2H-pyran-6-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,4-dihydroxyphenyl)-2-hydroxy-2-{[2-(4-hydroxyphenyl)ethyl]-C-hydroxycarbonimidoyl}ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]oxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,4-dihydroxyphenyl)-2-hydroxy-1-{[2-(4-hydroxyphenyl)ethyl]-C-hydroxycarbonimidoyl}ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-{3-[2-(4-hydroxyphenyl)ethyl]oxiran-2-yl}-3-phenylpropan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[3-hydroxy-1-(4-hydroxyphenyl)-5-oxo-7-phenylheptan-4-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-{3-[2-(4-hydroxyphenyl)ethyl]oxiran-2-yl}-3-phenylpropan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-hydroxy-1-(4-hydroxyphenyl)-5-oxo-7-phenylheptan-3-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-5-[3-(2,4-dihydroxyphenyl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-{4-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-3,5-dihydroxyphenyl}-1-(2,4-dihydroxyphenyl)-2-hydroxyethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-5-[3-(2,4-dihydroxyphenyl)oxiran-2-yl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{4-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-3,5-dihydroxyphenyl}-2-(2,4-dihydroxyphenyl)-2-hydroxyethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[3-(2,4-dihydroxybenzoyl)-4-(2,4-dihydroxyphenyl)-6-methyl-7-oxabicyclo[4.1.0]heptan-2-yl]-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-2-hydroxy-1-methylcyclohexyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[3-(2,4-dihydroxybenzoyl)-4-(2,4-dihydroxyphenyl)-6-methyl-7-oxabicyclo[4.1.0]heptan-2-yl]-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[5-(2,4-dihydroxybenzoyl)-4-(2,4-dihydroxyphenyl)-6-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-2-hydroxy-2-methylcyclohexyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-{12-methyl-3,10,13-trioxatetracyclo[7.6.0.0²,⁶.0¹²,¹⁴]pentadeca-1(9),2(6),4,7-tetraen-4-yl}benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-(3,5-dihydroxyphenyl)-13-hydroxy-12-methyl-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7-tetraen-12-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-{12-methyl-3,10,13-trioxatetracyclo[7.6.0.0²,⁶.0¹²,¹⁴]pentadeca-1(9),2(6),4,7-tetraen-4-yl}benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-(3,5-dihydroxyphenyl)-12-hydroxy-12-methyl-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7-tetraen-13-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-{7-methoxy-12-methyl-3,10,13-trioxatetracyclo[7.6.0.0²,⁶.0¹²,¹⁴]pentadeca-1(9),2(6),4,7-tetraen-4-yl}benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-(3,5-dihydroxyphenyl)-13-hydroxy-7-methoxy-12-methyl-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7-tetraen-12-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
7-methoxy-3-methyl-5-(3-methyloxiran-2-yl)-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1-hydroxy-1-[7-methoxy-3-methyl-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]propan-2-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
7-methoxy-3-methyl-5-(3-methyloxiran-2-yl)-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({2-hydroxy-1-[7-methoxy-3-methyl-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]propyl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-(3-{4-hydroxy-3-[(1E)-3-methylbuta-1,3-dien-1-yl]phenyl}oxiran-2-yl)benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,5-dihydroxyphenyl)-2-hydroxy-2-{4-hydroxy-3-[(1E)-3-methylbuta-1,3-dien-1-yl]phenyl}ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-(3-{4-hydroxy-3-[(1E)-3-methylbuta-1,3-dien-1-yl]phenyl}oxiran-2-yl)benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,5-dihydroxyphenyl)-2-hydroxy-1-{4-hydroxy-3-[(1E)-3-methylbuta-1,3-dien-1-yl]phenyl}ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-{4-hydroxy-3-[3-(prop-1-en-2-yl)oxiran-2-yl]phenyl}ethenyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{5-[(E)-2-(3,5-dihydroxyphenyl)ethenyl]-2-hydroxyphenyl}-2-hydroxy-3-methylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-{4-hydroxy-3-[3-(prop-1-en-2-yl)oxiran-2-yl]phenyl}ethenyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{5-[(E)-2-(3,5-dihydroxyphenyl)ethenyl]-2-hydroxyphenyl}-1-hydroxy-3-methylbut-3-en-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-{4-hydroxy-3-[2-(2-methyloxiran-2-yl)ethenyl]phenyl}ethenyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[(3E)-4-{5-[(E)-2-(3,5-dihydroxyphenyl)ethenyl]-2-hydroxyphenyl}-1-hydroxy-2-methylbut-3-en-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenyloxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-2-{[2-hydroxy-2-(4-methoxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-1-phenylethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenyloxirane-2-carboximidic acid → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-1-{[2-hydroxy-2-(4-methoxyphenyl)ethyl]-C-hydroxycarbonimidoyl}-2-phenylethyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
N-(4-aminobutyl)-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({2-[(4-aminobutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-1-(4-hydroxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-aminobutyl)-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({1-[(4-aminobutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-2-(4-hydroxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({2-[(4-amino-2-hydroxybutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-1-(4-hydroxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({1-[(4-amino-2-hydroxybutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-2-(4-hydroxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-aminobutyl)-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({1-[(4-aminobutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-aminobutyl)-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({2-[(4-aminobutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-1-(4-hydroxy-3-methoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-aminobutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({1-[(4-aminobutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-aminobutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({2-[(4-aminobutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-1-(4-hydroxy-3,5-dimethoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({1-[(4-amino-2-hydroxybutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → 2-amino-4-{[2-({2-[(4-amino-2-hydroxybutyl)-C-hydroxycarbonimidoyl]-2-hydroxy-1-(4-hydroxy-3-methoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)oxirane-2-carboxamide → 2-amino-4-{[2-({1-[(3-aminopropyl)({4-[(3-aminopropyl)amino]butyl})carbamoyl]-2-hydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)oxirane-2-carboxamide → 2-amino-4-{[2-({2-[(3-aminopropyl)({4-[(3-aminopropyl)amino]butyl})carbamoyl]-2-hydroxy-1-(4-hydroxy-3,5-dimethoxyphenyl)ethyl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
6-[(3,3-dimethyloxiran-2-yl)methyl]-5-hydroxy-8,8-dimethyl-2H,8H-pyrano[2,3-h]chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(3-hydroxy-1-{5-hydroxy-8,8-dimethyl-2-oxo-2H,8H-pyrano[2,3-h]chromen-6-yl}-3-methylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
6-[(3,3-dimethyloxiran-2-yl)methyl]-5-hydroxy-8,8-dimethyl-2H,8H-pyrano[2,3-h]chromen-2-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(3-hydroxy-4-{5-hydroxy-8,8-dimethyl-2-oxo-2H,8H-pyrano[2,3-h]chromen-6-yl}-2-methylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-9-(3-methylbut-2-en-1-yl)-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1,5,7,9-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[5,9-dihydroxy-8,8-dimethyl-6-(3-methylbut-2-en-1-yl)-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-9-(3-methylbut-2-en-1-yl)-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1,5,7,9-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[5,10-dihydroxy-8,8-dimethyl-6-(3-methylbut-2-en-1-yl)-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-6-methoxy-3,7-dioxabicyclo[4.1.0]heptan-2-one → 2-amino-4-{[2-({6-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-3-hydroxy-4-methoxy-2-oxooxan-4-yl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
4-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-6-methoxy-3,7-dioxabicyclo[4.1.0]heptan-2-one → 2-amino-4-{[2-({6-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-4-hydroxy-4-methoxy-2-oxooxan-3-yl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
6-[3-(2H-1,3-benzodioxol-5-yl)oxiran-2-yl]-4-methoxy-5,6-dihydro-2H-pyran-2-one → 2-amino-4-[(2-{[1-(2H-1,3-benzodioxol-5-yl)-2-hydroxy-2-(4-methoxy-6-oxo-3,6-dihydro-2H-pyran-2-yl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
6-[3-(2H-1,3-benzodioxol-5-yl)oxiran-2-yl]-4-methoxy-5,6-dihydro-2H-pyran-2-one → 2-amino-4-[(2-{[2-(2H-1,3-benzodioxol-5-yl)-2-hydroxy-1-(4-methoxy-6-oxo-3,6-dihydro-2H-pyran-2-yl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
6-[3-(2H-1,3-benzodioxol-5-yl)oxiran-2-yl]-4-methoxyoxan-2-one → 2-amino-4-[(2-{[1-(2H-1,3-benzodioxol-5-yl)-2-hydroxy-2-(4-methoxy-6-oxooxan-2-yl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
6-[3-(2H-1,3-benzodioxol-5-yl)oxiran-2-yl]-4-methoxyoxan-2-one → 2-amino-4-[(2-{[2-(2H-1,3-benzodioxol-5-yl)-2-hydroxy-1-(4-methoxy-6-oxooxan-2-yl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
4-{12,12-dimethyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),8-trien-5-yl}-3-methoxyphenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[14-hydroxy-5-(4-hydroxy-2-methoxyphenyl)-12,12-dimethyl-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-13-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-{12,12-dimethyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),8-trien-5-yl}-3-methoxyphenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[13-hydroxy-5-(4-hydroxy-2-methoxyphenyl)-12,12-dimethyl-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-14-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-{12,12-dimethyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),8-trien-5-yl}-5-methoxyphenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[14-hydroxy-5-(2-hydroxy-4-methoxyphenyl)-12,12-dimethyl-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-13-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-{12,12-dimethyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1(10),2(7),8-trien-5-yl}-5-methoxyphenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[13-hydroxy-5-(2-hydroxy-4-methoxyphenyl)-12,12-dimethyl-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-14-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(3-hydroxy-4-methoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-hydroxy-2-(3-hydroxy-4-methoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(3-hydroxy-4-methoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-2-hydroxy-1-(3-hydroxy-4-methoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(3-hydroxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-2-hydroxy-1-(3-hydroxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(3-hydroxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-hydroxy-2-(3-hydroxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
2-benzoyl-3-phenyloxirane → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-3-oxo-1,3-diphenylpropyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-benzoyl-3-phenyloxirane → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-3-oxo-1,3-diphenylpropan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[3-(hydroxymethyl)oxiran-2-yl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2,3-dihydroxy-1-(4-hydroxyphenyl)propyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[3-(hydroxymethyl)oxiran-2-yl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1,3-dihydroxy-1-(4-hydroxyphenyl)propan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2E)-3-(3,4-dihydroxyphenyl)prop-2-enal → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,4-dihydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-hydroxyphenyl)oxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-1-(4-hydroxyphenyl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-hydroxyphenyl)oxirane-2-carbaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-1-(4-hydroxyphenyl)-3-oxopropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[3-(3,5-dihydroxyphenyl)oxiran-2-yl]benzene-1,2-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(3,4-dihydroxyphenyl)-2-(3,5-dihydroxyphenyl)-2-hydroxyethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[3-(3,5-dihydroxyphenyl)oxiran-2-yl]benzene-1,2-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3,4-dihydroxyphenyl)-1-(3,5-dihydroxyphenyl)-2-hydroxyethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
12-methoxy-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraene-17,19-dione → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({5-hydroxy-11-methoxy-16,18-dioxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraen-4-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(3R,8S)-12-hydroxy-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraene-17,19-dione → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({5,11-dihydroxy-16,18-dioxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraen-4-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(3R,8S)-15-hydroxy-12-methoxy-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraene-17,19-dione → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({5,14-dihydroxy-11-methoxy-16,18-dioxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraen-4-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(3R,8S)-17-hydroxy-12-methoxy-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraen-19-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({5,16-dihydroxy-11-methoxy-18-oxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraen-4-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2,3,4-trimethoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-hydroxy-2-(2,3,4-trimethoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(2,3,4-trimethoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-2-hydroxy-1-(2,3,4-trimethoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyloxirane-2-carboxamide → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-cyano-1-(diethylcarbamoyl)-2-(3,4-dihydroxy-5-nitrophenyl)-2-hydroxyethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyloxirane-2-carboxamide → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-cyano-2-(diethylcarbamoyl)-1-(3,4-dihydroxy-5-nitrophenyl)-2-hydroxyethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
{2-[4-(3-ethyl-2,3-diphenyloxiran-2-yl)phenoxy]ethyl}(methyl)amine → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-hydroxy-1-{4-[2-(methylamino)ethoxy]phenyl}-1,2-diphenylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
{2-[4-(3-ethyl-2,3-diphenyloxiran-2-yl)phenoxy]ethyl}(methyl)amine → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2-hydroxy-1-{4-[2-(methylamino)ethoxy]phenyl}-1,2-diphenylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2-{4-[2-(dimethylamino)ethoxy]phenyl}-3-ethyl-3-phenyloxiran-2-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{4-[2-(dimethylamino)ethoxy]phenyl}-1-hydroxy-1-(3-hydroxyphenyl)-2-phenylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(2-{4-[2-(dimethylamino)ethoxy]phenyl}-3-ethyl-3-phenyloxiran-2-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-hydroxy-1-(3-hydroxyphenyl)-2-phenylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[2,3-diethyl-3-(4-hydroxyphenyl)oxiran-2-yl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-hydroxy-3,4-bis(4-hydroxyphenyl)hexan-3-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-chloro-4-{4-[2-(dimethylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-2-ol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]phenyl}-2-hydroxy-3,4-diphenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]phenyl}-4-(2-hydroxyphenyl)-3-phenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-1-phenylbut-1-en-2-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]phenyl}-3-(2-hydroxyphenyl)-4-phenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-(4-chloro-1,2-diphenylbut-1-en-1-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-(4-hydroxyphenyl)-3,4-diphenylbut-3-en-1-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[4-(4-chloro-1,2-diphenylbut-1-en-1-yl)phenoxy]acetaldehyde → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-[4-(2-oxoethoxy)phenyl]-3,4-diphenylbut-3-en-1-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
{2-[4-(4-chloro-1,2-diphenylbut-1-en-1-yl)phenoxy]ethyl}(methyl)amine → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(methylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-(4-chloro-1,2-diphenylbut-1-en-1-yl)-5-[2-(dimethylamino)ethoxy]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]-2-hydroxyphenyl}-3,4-diphenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[4-(4-chloro-1,2-diphenylbut-1-en-1-yl)phenoxy]-N,N-dimethylethanamine oxide → 2-{4-[4-({2-[(4-amino-4-carboxy-1-hydroxybutylidene)amino]-2-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}sulfanyl)-1,2-diphenylbut-1-en-1-yl]phenoxy}-N,N-dimethylethanamine oxide details
4-(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]phenyl}-4-(4-hydroxyphenyl)-3-phenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-1-phenylbut-1-en-2-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]phenyl}-3-(4-hydroxyphenyl)-4-phenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]phenyl}-4-(3-hydroxyphenyl)-3-phenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-1-phenylbut-1-en-2-yl)phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)ethoxy]phenyl}-3-(3-hydroxyphenyl)-4-phenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2-{4-[3-(2-chloroethyl)-2,3-diphenyloxiran-2-yl]phenoxy}ethyl)dimethylamine → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-hydroxy-1,2-diphenylbutyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2-{4-[3-(2-chloroethyl)-2,3-diphenyloxiran-2-yl]phenoxy}ethyl)dimethylamine → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-chloro-1-{4-[2-(dimethylamino)ethoxy]phenyl}-1-hydroxy-1,2-diphenylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2-{4-[3-(2-chloroethyl)-2,3-diphenyloxiran-2-yl]phenoxy}ethyl)dimethylamine → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-(3-{4-[2-(dimethylamino)ethoxy]phenyl}-2,3-diphenyloxiran-2-yl)ethyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[4-(4-chloro-1,2-diphenylbut-1-en-1-yl)phenoxy]-1-(dimethylamino)ethan-1-ol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[2-(dimethylamino)-2-hydroxyethoxy]phenyl}-3,4-diphenylbut-3-en-1-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
11-[(2R,3S)-3-[2-amino-3-methyl-4-(2-methyl-1,3-thiazol-4-yl)but-3-en-1-yl]-2-methyloxiran-2-yl]-3,7-dihydroxy-4,4,6,8-tetramethyl-5-oxoundecanoic acid → (12R)-15-amino-13-({2-[(4-amino-4-carboxy-1-hydroxybutylidene)amino]-2-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}sulfanyl)-3,7,12-trihydroxy-4,4,6,8,12,16-hexamethyl-17-(2-methyl-1,3-thiazol-4-yl)-5-oxoheptadec-16-enoic acid details
11-[(2R,3S)-3-[2-amino-3-methyl-4-(2-methyl-1,3-thiazol-4-yl)but-3-en-1-yl]-2-methyloxiran-2-yl]-3,7-dihydroxy-4,4,6,8-tetramethyl-5-oxoundecanoic acid → 15-amino-12-({2-[(4-amino-4-carboxy-1-hydroxybutylidene)amino]-2-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl}sulfanyl)-3,7,13-trihydroxy-4,4,6,8,12,16-hexamethyl-17-(2-methyl-1,3-thiazol-4-yl)-5-oxoheptadec-16-enoic acid details
(1S,16R)-5,7,10,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[(5R)-5,10,11,14,16-pentahydroxy-5,9,11,13,13-pentamethyl-2-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-oxo-1-azacyclohexadec-1(16)-en-4-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(1S,16R)-5,7,10,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4,10,11,14,16-pentahydroxy-5,9,11,13,13-pentamethyl-2-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-oxo-1-azacyclohexadec-1(16)-en-5-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(1S,16R)-5,7,11,12-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[(5R)-5,9,10,14,16-pentahydroxy-5,9,11,13,13-pentamethyl-2-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-oxo-1-azacyclohexadec-1(16)-en-4-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(1S,16R)-5,7,11,12-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4,9,10,14,16-pentahydroxy-5,9,11,13,13-pentamethyl-2-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-oxo-1-azacyclohexadec-1(16)-en-5-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(1S,16R)-5,6,7,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[(5R)-5,10,14,15,16-pentahydroxy-5,9,11,13,13-pentamethyl-2-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-oxo-1-azacyclohexadec-1(16)-en-4-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(1S,16R)-5,6,7,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4,10,14,15,16-pentahydroxy-5,9,11,13,13-pentamethyl-2-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-oxo-1-azacyclohexadec-1(16)-en-5-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(2,4-dihydroxyphenyl)-2-{3-[(3,3-dimethyloxiran-2-yl)methyl]-4,6-dihydroxy-2-methoxyphenyl}ethan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{3-[2-(2,4-dihydroxyphenyl)-2-oxoethyl]-4,6-dihydroxy-2-methoxyphenyl}-3-hydroxy-2-methylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-{3-[(3,3-dimethyloxiran-2-yl)methyl]-4,6-dihydroxy-2-methoxyphenyl}acetic acid → 2-amino-4-{[2-({4-[3-(carboxymethyl)-4,6-dihydroxy-2-methoxyphenyl]-3-hydroxy-2-methylbutan-2-yl}sulfanyl)-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl]-C-hydroxycarbonimidoyl}butanoic acid details
5-[3-(2,4-dihydroxyphenyl)oxiran-2-yl]-2-(3-methylbut-2-en-1-yl)benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({2-[3,5-dihydroxy-4-(3-methylbut-2-en-1-yl)phenyl]-1-(2,4-dihydroxyphenyl)-2-hydroxyethyl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[3-(2,4-dihydroxyphenyl)oxiran-2-yl]-2-(3-methylbut-2-en-1-yl)benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({1-[3,5-dihydroxy-4-(3-methylbut-2-en-1-yl)phenyl]-2-(2,4-dihydroxyphenyl)-2-hydroxyethyl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-3-hydroxy-3-methylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(4-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-3-hydroxy-2-methylbutan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)oxirane-2-carbonyl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-hydroxy-3-(4-hydroxyphenyl)-1-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)-3-oxopropan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
4-[3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)oxirane-2-carbonyl]phenol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[2-hydroxy-3-(4-hydroxyphenyl)-1-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)-3-oxopropyl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(4-hydroxyphenyl)-3-{11-methoxy-5,5-dimethyl-3,6-dioxatricyclo[5.4.0.0²,⁴]undeca-1(7),8,10-trien-10-yl}prop-2-en-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-hydroxy-6-[3-(4-hydroxyphenyl)-3-oxoprop-1-en-1-yl]-5-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-3-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(4-hydroxyphenyl)-3-{11-methoxy-5,5-dimethyl-3,6-dioxatricyclo[5.4.0.0²,⁴]undeca-1(7),8,10-trien-10-yl}prop-2-en-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({3-hydroxy-6-[3-(4-hydroxyphenyl)-3-oxoprop-1-en-1-yl]-5-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(4-hydroxyphenyl)-3-{11-methoxy-5,5-dimethyl-3,6-dioxatricyclo[5.4.0.0²,⁴]undeca-1(7),8,10-trien-10-yl}propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({4-hydroxy-6-[3-(4-hydroxyphenyl)-3-oxopropyl]-5-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-3-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
1-(4-hydroxyphenyl)-3-{11-methoxy-5,5-dimethyl-3,6-dioxatricyclo[5.4.0.0²,⁴]undeca-1(7),8,10-trien-10-yl}propan-1-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({3-hydroxy-6-[3-(4-hydroxyphenyl)-3-oxopropyl]-5-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-9-(2-methylpropanoyl)-6-phenyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1,5,7,9-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[5,9-dihydroxy-8,8-dimethyl-6-(2-methylpropanoyl)-2-oxo-4-phenyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
8-hydroxy-12,12-dimethyl-9-(2-methylpropanoyl)-6-phenyl-3,11,14-trioxatetracyclo[8.5.0.0²,⁷.0¹³,¹⁵]pentadeca-1,5,7,9-tetraen-4-one → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[5,10-dihydroxy-8,8-dimethyl-6-(2-methylpropanoyl)-2-oxo-4-phenyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[4-(2,6-dihydroxyphenyl)-3-hydroxy-2-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
2-[(3,3-dimethyloxiran-2-yl)methyl]benzene-1,3-diol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-{[1-(2,6-dihydroxyphenyl)-3-hydroxy-3-methylbutan-2-yl]sulfanyl}ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2-pentyl-3-phenyloxiran-2-yl)methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(2,3-dihydroxy-2-pentyl-1-phenylpropyl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
(2-pentyl-3-phenyloxiran-2-yl)methanol → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-[(1,3-dihydroxy-2-pentyl-1-phenylpropan-2-yl)sulfanyl]ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3,5-dihydroxy-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]cyclohexa-2,5-diene-1,4-dione → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({2,4-dihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-3,6-dioxocyclohexa-1,4-dien-1-yl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3,5-dihydroxy-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]cyclohexa-2,5-diene-1,4-dione → 2-amino-4-({1-[(carboxymethyl)-C-hydroxycarbonimidoyl]-2-({2,3,4,6-tetrahydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]phenyl}sulfanyl)ethyl}-C-hydroxycarbonimidoyl)butanoic acid details
3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[1-carboxy-2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboxylic acid → 2-amino-4-[(2-{[2-carboxy-2-hydroxy-1-(4-hydroxy-3-methoxyphenyl)ethyl]sulfanyl}-1-[(carboxymethyl)-C-hydroxycarbonimidoyl]ethyl)-C-hydroxycarbonimidoyl]butanoic acid details
GO Classification
Biological Process
negative regulation of apoptotic process
negative regulation of fibroblast proliferation
common myeloid progenitor cell proliferation
negative regulation of acute inflammatory response
negative regulation of I-kappaB kinase/NF-kappaB cascade
negative regulation of interleukin-1 beta production
negative regulation of leukocyte proliferation
negative regulation of monocyte chemotactic protein-1 production
negative regulation of necrotic cell death
negative regulation of nitric-oxide synthase biosynthetic process
negative regulation of stress-activated MAPK cascade
negative regulation of tumor necrosis factor production
negative regulation of tumor necrosis factor-mediated signaling pathway
nitric oxide storage
positive regulation of superoxide anion generation
response to reactive oxygen species
glutathione metabolic process
cellular response to lipopolysaccharide
xenobiotic metabolic process
negative regulation of JUN kinase activity
negative regulation of ERK1 and ERK2 cascade
central nervous system development
Cellular Component
cytosol
mitochondrion
nucleus
TRAF2-GSTP1 complex
Function
catalytic activity
transferase activity
transferase activity, transferring alkyl or aryl (other than methyl) groups
glutathione transferase activity
Molecular Function
glutathione transferase activity
dinitrosyl-iron complex binding
JUN kinase binding
kinase regulator activity
nitric oxide binding
S-nitrosoglutathione binding
Process
metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q13
SNPs GSTP1
Gene Sequence
>632 bp
TGCCGCCCTACACCGTGGTCTATTTCCCAGTTCGAGGCCGCTGCGCGGCCCTGCGCATGC
TGCTGGCAGATCAGGGCCAGAGCTGGAAGGAGGAGGTGGTGACCGTGGAGACGTGGCAGG
AGGGCTCACTCAAAGCCTCCTGCCTATACGGGCAGCTCCCCAAGTTCCAGGACGGAGACC
TCACCCTGTACCAGTCCAATACCATCCTGCGTCACCTGGGCCGCACCCTTGGGCTCTATG
GGAAGGACCAGCAGGAGGCAGCCCTGGTGGACATGGTGAATGACGGCGTGGAGGACCTCC
GCTGCAAATACATCTCCCTCATCTACACCAACTATGAGGCGGGCAAGGATGACTATGTGA
AGGCACTGCCCGGGCAACTGAAGCCTTTTGAGACCCTGCTGTCCCAGAACCAGGGAGGCA
AGACCTTCATTGTGGGAGACCAGATCTCCTTCGCTGACTACAACCTGCTGGACTTGCTGC
TGATCCATGAGGTCCTAGCCCCTGGCTGCCTGGATGCGTTCCCCCTGCTCTCAGCATATG
TGGGGCGCCTCAGTGCCCGGCCCAAGCTCAAGGCCTTCCTGGCCTCCCCTGAGTACGTGA
ACCTCCCCATCAATGGCAACGGGAAACAGTGA
Protein Properties
Number of Residues 210
Molecular Weight 23355.625
Theoretical pI 5.64
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glutathione S-transferase P
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
GenBank ID Protein 32187525
UniProtKB/Swiss-Prot ID P09211
UniProtKB/Swiss-Prot Entry Name GSTP1_HUMAN
PDB IDs
GenBank Gene ID AY324387
GeneCard ID GSTP1
GenAtlas ID GSTP1
HGNC ID HGNC:4638
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  4. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  5. Ji H, Reid GE, Moritz RL, Eddes JS, Burgess AW, Simpson RJ: A two-dimensional gel database of human colon carcinoma proteins. Electrophoresis. 1997 Mar-Apr;18(3-4):605-13. [PubMed:9150948 ]
  6. Alin P, Mannervik B, Jornvall H: Structural evidence for three different types of glutathione transferase in human tissues. FEBS Lett. 1985 Mar 25;182(2):319-22. [PubMed:3979555 ]
  7. Mannervik B, Alin P, Guthenberg C, Jensson H, Tahir MK, Warholm M, Jornvall H: Identification of three classes of cytosolic glutathione transferase common to several mammalian species: correlation between structural data and enzymatic properties. Proc Natl Acad Sci U S A. 1985 Nov;82(21):7202-6. [PubMed:3864155 ]
  8. Kano T, Sakai M, Muramatsu M: Structure and expression of a human class pi glutathione S-transferase messenger RNA. Cancer Res. 1987 Nov 1;47(21):5626-30. [PubMed:3664469 ]
  9. Cowell IG, Dixon KH, Pemble SE, Ketterer B, Taylor JB: The structure of the human glutathione S-transferase pi gene. Biochem J. 1988 Oct 1;255(1):79-83. [PubMed:3196325 ]
  10. Morrow CS, Cowan KH, Goldsmith ME: Structure of the human genomic glutathione S-transferase-pi gene. Gene. 1989 Jan 30;75(1):3-11. [PubMed:2542132 ]
  11. Moscow JA, Fairchild CR, Madden MJ, Ransom DT, Wieand HS, O'Brien EE, Poplack DG, Cossman J, Myers CE, Cowan KH: Expression of anionic glutathione-S-transferase and P-glycoprotein genes in human tissues and tumors. Cancer Res. 1989 Mar 15;49(6):1422-8. [PubMed:2466554 ]
  12. Ali-Osman F, Akande O, Antoun G, Mao JX, Buolamwini J: Molecular cloning, characterization, and expression in Escherichia coli of full-length cDNAs of three human glutathione S-transferase Pi gene variants. Evidence for differential catalytic activity of the encoded proteins. J Biol Chem. 1997 Apr 11;272(15):10004-12. [PubMed:9092542 ]
  13. Singh SV, Ahmad H, Kurosky A, Awasthi YC: Purification and characterization of unique glutathione S-transferases from human muscle. Arch Biochem Biophys. 1988 Jul;264(1):13-22. [PubMed:3395118 ]
  14. Ahmad H, Wilson DE, Fritz RR, Singh SV, Medh RD, Nagle GT, Awasthi YC, Kurosky A: Primary and secondary structural analyses of glutathione S-transferase pi from human placenta. Arch Biochem Biophys. 1990 May 1;278(2):398-408. [PubMed:2327795 ]
  15. Reinemer P, Dirr HW, Ladenstein R, Huber R, Lo Bello M, Federici G, Parker MW: Three-dimensional structure of class pi glutathione S-transferase from human placenta in complex with S-hexylglutathione at 2.8 A resolution. J Mol Biol. 1992 Sep 5;227(1):214-26. [PubMed:1522586 ]
  16. Oakley AJ, Rossjohn J, Lo Bello M, Caccuri AM, Federici G, Parker MW: The three-dimensional structure of the human Pi class glutathione transferase P1-1 in complex with the inhibitor ethacrynic acid and its glutathione conjugate. Biochemistry. 1997 Jan 21;36(3):576-85. [PubMed:9012673 ]
  17. Ji X, Tordova M, O'Donnell R, Parsons JF, Hayden JB, Gilliland GL, Zimniak P: Structure and function of the xenobiotic substrate-binding site and location of a potential non-substrate-binding site in a class pi glutathione S-transferase. Biochemistry. 1997 Aug 12;36(32):9690-702. [PubMed:9245401 ]
  18. Oakley AJ, Lo Bello M, Battistoni A, Ricci G, Rossjohn J, Villar HO, Parker MW: The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution. J Mol Biol. 1997 Nov 21;274(1):84-100. [PubMed:9398518 ]
  19. Prade L, Huber R, Manoharan TH, Fahl WE, Reuter W: Structures of class pi glutathione S-transferase from human placenta in complex with substrate, transition-state analogue and inhibitor. Structure. 1997 Oct 15;5(10):1287-95. [PubMed:9351803 ]
  20. Ji X, Blaszczyk J, Xiao B, O'Donnell R, Hu X, Herzog C, Singh SV, Zimniak P: Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1. Biochemistry. 1999 Aug 10;38(32):10231-8. [PubMed:10441116 ]
  21. Nicotra M, Paci M, Sette M, Oakley AJ, Parker MW, Lo Bello M, Caccuri AM, Federici G, Ricci G: Solution structure of glutathione bound to human glutathione transferase P1-1: comparison of NMR measurements with the crystal structure. Biochemistry. 1998 Mar 3;37(9):3020-7. [PubMed:9485454 ]
  22. Kong KH, Inoue H, Takahashi K: Site-directed mutagenesis study on the roles of evolutionally conserved aspartic acid residues in human glutathione S-transferase P1-1. Protein Eng. 1993 Jan;6(1):93-9. [PubMed:8433974 ]