You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00840
Secondary Accession Numbers
  • 6121
  • HMDBP07397
Name Inositol oxygenase
Synonyms
  1. Aldehyde reductase-like 6
  2. Kidney-specific protein 32
  3. MI oxygenase
  4. Myo-inositol oxygenase
  5. Renal-specific oxidoreductase
  6. SubName: Myo-inositol oxygenase
  7. SubName: Myo-inositol oxygenase, isoform CRA_d
Gene Name MIOX
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function Not Available
Pathways
  • Ascorbate and aldarate metabolism
  • Inositol Metabolism
  • Inositol phosphate metabolism
  • myo-inositol degradation into D-glucuronate
Reactions
myo-Inositol + Oxygen → D-Glucuronic acid + Water details
GO Classification
Biological Process
inositol catabolic process
Cellular Component
cytoplasm
inclusion body
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
transition metal ion binding
iron ion binding
oxidoreductase activity
inositol oxygenase activity
Molecular Function
ferric iron binding
NADP binding
aldo-keto reductase (NADP) activity
oxidoreductase activity, acting on NADH or NADPH
inositol oxygenase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
oxidation reduction
inositol metabolic process
inositol catabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 22
Locus 22q13.3
SNPs MIOX
Gene Sequence
>858 bp
ATGAAGGTCGATGTGGGCCCAGACCCTTCCCTGGTCTACCGACCTGATGTGGACCCAGAG
GTGGCCAAAGACAAGGCCAGCTTCCGGAACTACACGTCAGGTCCCCTCCTGGACCGTGTC
TTCACCACCTACAAGCTCATGCACACGCACCAGACAGTGGACTTCGTCAGGAGCAAGCAT
GCCCAGTTTGGGGGCTTCTCCTACAAGAAAATGACAGTCATGGAGGCCGTGGACCTGCTG
GATGGGCTGGTGGATGAGTCGGACCCGGACGTAGATTTCCCCAACTCCTTCCATGCCTTC
CAGACAGCGGAGGGCATCCGGAAGGCCCACCCAGACAAGGACTGGTTCCACCTCGTCGGG
CTCCTGCACGACCTGGGGAAGGTCCTGGCCCTGTTCGGGGAGCCCCAGTGGGCTGTCGTC
GGCGACACCTTCCCCGTCGGATGCCGTCCGCAGGCCTCCGTGGTTTTCTGCGACTCCACC
TTCCAGGACAACCCTGACCTCCAGGATCCTCGATACAGCACAGAGCTCGGGATGTATCAG
CCCCACTGTGGGCTCGACAGGGTCCTCATGTCCTGGGGCCATGATGAGTACATGTACCAG
GTGATGAAGTTTAACAAGTTCTCACTGCCCCCTGAGGCTTTCTACATGATCCGGTTCCAC
TCCTTCTACCCCTGGCACACGGGCCGCGACTACCAGCAGCTGTGCAGCCAGCAGGACCTG
GCCATGCTGCCCTGGGTGCGGGAGTTCAACAAGTTCGACCTCTACACCAAGTGCCCGGAC
CTGCCGGACGTGGACAAGCTGCGGCCCTACTACCAGGGGCTCATTGACAAGTACTGCCCG
GGCACCCTGAGCTGGTGA
Protein Properties
Number of Residues 285
Molecular Weight 33009.33
Theoretical pI 5.89
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol oxygenase
MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKH
AQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQ
PHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDL
AMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW
GenBank ID Protein 6694290
UniProtKB/Swiss-Prot ID Q9UGB7
UniProtKB/Swiss-Prot Entry Name MIOX_HUMAN
PDB IDs
GenBank Gene ID AF197129
GeneCard ID MIOX
GenAtlas ID MIOX
HGNC ID HGNC:14522
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  5. Yang Q, Dixit B, Wada J, Tian Y, Wallner EI, Srivastva SK, Kanwar YS: Identification of a renal-specific oxido-reductase in newborn diabetic mice. Proc Natl Acad Sci U S A. 2000 Aug 29;97(18):9896-901. [PubMed:10944187 ]
  6. Arner RJ, Prabhu KS, Reddy CC: Molecular cloning, expression, and characterization of myo-inositol oxygenase from mouse, rat, and human kidney. Biochem Biophys Res Commun. 2004 Nov 26;324(4):1386-92. [PubMed:15504367 ]