You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00856
Secondary Accession Numbers
  • 6137
Name Ethanolamine kinase 1
Synonyms
  1. EKI 1
Gene Name ETNK1
Protein Type Enzyme
Biological Properties
General Function Cell wall/membrane/envelope biogenesis
Specific Function Highly specific for ethanolamine phosphorylation. May be a rate-controlling step in phosphatidylethanolamine biosynthesis.
Pathways
  • Glycerophospholipid metabolism
  • phosphatidylethanolamine biosynthesis
Reactions
Adenosine triphosphate + Ethanolamine → ADP + O-Phosphoethanolamine details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylethanolamine biosynthetic process
Cellular Component
cytosol
Molecular Function
ATP binding
ethanolamine kinase activity
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 12
Locus 12p12.1
SNPs ETNK1
Gene Sequence
>1359 bp
ATGCTCTGCGGCCGCCCGCGGTCCAGCTCCGACAACAGGAATTTTCTCCGAGAGCGGGCC
GGGCTCAGTTCAGCTGCTGTCCAGACCCGGATCGGCAACAGTGCCGCCTCCAGACGTTCT
CCTGCCGCTCGCCCGCCCGTCCCAGCGCCCCCAGCCCTCCCGCGAGGGCGCCCCGGGACG
GAAGGATCCACCAGTCTGTCGGCGCCCGCCGTTCTCGTGGTCGCCGTCGCCGTCGTCGTG
GTGGTAGTCTCCGCCGTCGCCTGGGCCATGGCCAATTACATCCACGTCCCTCCCGGCTCC
CCGGAGGTGCCCAAGCTGAACGTCACCGTTCAGGATCAGGAGGAGCATCGCTGCCGGGAG
GGGGCCCTGAGCCTCCTGCAACACCTGCGGCCTCACTGGGACCCCCAGGAGGTGACCCTG
CAGCTCTTCACAGATGGAATCACAAATAAACTTATTGGCTGTTACGTGGGAAACACCATG
GAGGATGTAGTCCTGGTGAGAATTTATGGCAATAAGACTGAGTTATTAGTCGATCGAGAT
GAGGAAGTAAAGAGTTTTCGAGTGTTGCAGGCTCATGGGTGTGCACCACAACTCTACTGT
ACCTTCAATAATGGACTATGCTATGAATTTATACAAGGAGAAGCACTGGATCCAAAGCAT
GTCTGCAACCCAGCCATTTTCAGGCTAATAGCTCGTCAGCTTGCTAAAATCCATGCTATT
CATGCACACAATGGCTGGATCCCCAAATCTAATCTTTGGCTAAAGATGGGAAAGTATTTC
TCTCTCATTCCCACAGGATTTGCAGATGAAGACATTAATAAAAGGTTCCTAAGTGATATC
CCAAGCTCTCAGATTCTCCAGGAAGAGATGACTTGGATGAAGGAGATTCTTTCCAACCTG
GGCTCACCTGTTGTGCTTTGCCATAATGACCTATTGTGTAAGAATATAATCTACAATGAG
AAACAAGGTGATGTACAGTTCATTGATTATGAATATTCTGGATACAACTACCTGGCATAT
GATATTGGAAATCATTTCAATGAATTTGCAGGTGTGAGTGATGTAGACTATAGTCTGTAT
CCAGATAGAGAACTACAGAGTCAGTGGCTGCGTGCTTACCTTGAAGCCTACAAAGAATTT
AAGGGCTTTGGGACTGAAGTTACTGAAAAGGAGGTAGAAATACTCTTCATTCAAGTCAAT
CAGTTTGCATTGGCTTCTCATTTCTTTTGGGGATTGTGGGCTTTGATTCAAGCCAAATAC
TCCACTATTGAGTTTGATTTCCTTGGGTATGCAATTGTTCGTTTTAACCAGTACTTTAAA
ATGAAGCCTGAGGTTACTGCATTAAAAGTGCCTGAGTAA
Protein Properties
Number of Residues 452
Molecular Weight 27994.955
Theoretical pI 8.49
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ethanolamine kinase 1
MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGT
EGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCRE
GALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRD
EEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAI
HAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNL
GSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLY
PDRELQSQWLRAYLEAYKEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKY
STIEFDFLGYAIVRFNQYFKMKPEVTALKVPE
GenBank ID Protein 9998952
UniProtKB/Swiss-Prot ID Q9HBU6
UniProtKB/Swiss-Prot Entry Name EKI1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF207600
GeneCard ID ETNK1
GenAtlas ID ETNK1
HGNC ID HGNC:24649
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Lykidis A, Wang J, Karim MA, Jackowski S: Overexpression of a mammalian ethanolamine-specific kinase accelerates the CDP-ethanolamine pathway. J Biol Chem. 2001 Jan 19;276(3):2174-9. Epub 2000 Oct 23. [PubMed:11044454 ]