You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00859
Secondary Accession Numbers
  • 6140
  • HMDBP06007
Name NADP-dependent malic enzyme, mitochondrial
Synonyms
  1. Malic enzyme 3
  2. NADP-ME
Gene Name ME3
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Not Available
Pathways
  • Pyruvate metabolism
Reactions
Malic acid + NADP → Pyruvic acid + CO(2) + NADPH details
Oxalacetic acid → Pyruvic acid + CO(2) details
Malic acid + NADP → Pyruvic acid + Carbon dioxide + NADPH + Hydrogen Ion details
GO Classification
Biological Process
malate metabolic process
pyruvate metabolic process
aerobic respiration
oxygen metabolic process
Cellular Component
mitochondrial matrix
mitochondrion
Function
ion binding
cation binding
metal ion binding
binding
nucleotide binding
catalytic activity
nad or nadh binding
oxidoreductase activity, acting on the ch-oh group of donors, nad or nadp as acceptor
oxidoreductase activity, acting on ch-oh group of donors
oxidoreductase activity
malate dehydrogenase activity
malic enzyme activity
Molecular Function
NAD binding
metal ion binding
cofactor binding
malate dehydrogenase (oxaloacetate-decarboxylating) activity
malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
oxidation reduction
dicarboxylic acid metabolic process
malate metabolic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 11
Locus 11cen-q22.3
SNPs ME3
Gene Sequence
>1815 bp
ATGGGTGCCGCGCTGGGGACAGGCACGCGGCTGGCTCCCTGGCCGGGCCGGGCCTGCGGC
GCCCTCCCGCGCTGGACACCCACCGCGCCCGCCCAAGGCTGCCACTCCAAGCCTGGCCCG
GCGCGCCCTGTGCCCCTGAAGAAGCGCGGATACGATGTCACCAGGAACCCTCATCTCAAC
AAGGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCG
CCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAG
CAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTC
TTCTACCGAGTGCTGACTTCGGATGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACC
GTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATC
ACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATT
AAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTAC
GGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCG
CAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGAC
CCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTG
GATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAA
GACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATG
TTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGCTGCTCTG
CGAATCACCAACAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCA
GCTATGGGCATTGCCCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCA
GAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGGGAGGAGC
CACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAG
GAGGTGGTGAGGCTGGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCC
TTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCATCTTTGCC
CTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAG
GGCCGAGGGATTTTTGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAG
ACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACTGGGAGTC
ATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATT
GCCCAGGAAGTCTCTGAGCAGCATCTGTCCCAGGGGAGACTCTATCCACCACTCAGCACC
ATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAAACACAAC
CTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTAC
ACTCCAGACTATGACTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAAT
GTTCAGACGGTCTGA
Protein Properties
Number of Residues 604
Molecular Weight 67067.875
Theoretical pI 7.978
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADP-dependent malic enzyme, mitochondrial
MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN
KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI
KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD
PLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKA
EATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGK
TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLST
IRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMN
VQTV
GenBank ID Protein 535012
UniProtKB/Swiss-Prot ID Q16798
UniProtKB/Swiss-Prot Entry Name MAON_HUMAN
PDB IDs Not Available
GenBank Gene ID X79440
GeneCard ID ME3
GenAtlas ID ME3
HGNC ID HGNC:6985
References
General References
  1. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  2. Loeber G, Maurer-Fogy I, Schwendenwein R: Purification, cDNA cloning and heterologous expression of the human mitochondrial NADP(+)-dependent malic enzyme. Biochem J. 1994 Dec 15;304 ( Pt 3):687-92. [PubMed:7818469 ]