You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00867
Secondary Accession Numbers
  • 6149
Name Alpha-mannosidase 2
Synonyms
  1. AMan II
  2. Golgi alpha-mannosidase II
  3. Man II
  4. Mannosidase alpha class 2A member 1
  5. Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
Gene Name MAN2A1
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
+ Water → + D-Mannose details
GO Classification
Biological Process
N-glycan processing
in utero embryonic development
respiratory gaseous exchange
liver development
post-translational protein modification
protein N-linked glycosylation via asparagine
mannose metabolic process
vacuole organization
mitochondrion organization
lung alveolus development
Cellular Component
integral to membrane
Golgi membrane
Function
alpha-mannosidase activity
mannosidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
transition metal ion binding
zinc ion binding
carbohydrate binding
Molecular Function
metal ion binding
carbohydrate binding
zinc ion binding
hydrolase activity, hydrolyzing N-glycosyl compounds
mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
mannose metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 5
Locus 5q21-q22
SNPs MAN2A1
Gene Sequence
>3435 bp
ATGAAGTTAAGCCGCCAGTTCACCGTGTTCGGCAGTGCGATCTTCTGTGTGGTGATTTTC
TCGCTCTACCTGATGCTGGACCGGGGTCACTTAGACTACCCCAGGAACCCGCGCCGCGAG
GGCTCCTTCCCTCAGGGCCAGCTCTCAATGTTGCAAGAAAAAATAGACCATTTGGAGCGT
TTGCTAGCTGAGAATAATGAGATCATCTCAAATATTAGAGACTCAGTCATCAATTTGAGT
GAGTCTGTGGAGGATGGTCCGAAAAGTTCACAAAGCAATTTCAGCCAAGGTGCTGGCTCA
CATCTTCTGCCCTCACAATTATCCCTCTCAGTTGACACTGCAGACTGTCTGTTTGCTTCA
CAAAGTGGAAGTCACAATTCAGATGTGCAGATGTTGGATGTTTACAGTCTAATTTCTTTT
GACAATCCAGATGGTGGAGTTTGGAAGCAAGGATTTGACATTACTTATGAATCTAATGAA
TGGGACACTGAACCCCTTCAAGTCTTTGTGGTGCCTCATTCCCATAACGACCCAGGTTGG
TTGAAGACTTTCAATGACTACTTTAGAGACAAGACTCAGTATATTTTTAATAACATGGTC
CTAAAGCTGAAAGAAGACTCACGGAGGAAGTTTATTTGGTCTGAGATCTCTTACCTTTCA
AAGTGGTGGGATATTATAGATATTCAGAAGAAGGATGCTGTTAAAAGTTTAATAGAAAAT
GGTCAGCTTGAAATTGTGACAGGTGGCTGGGTTATGCCTGATGAAGCTACTCCACATTAT
TTTGCCTTAATTGATCAACTAATTGAAGGACATCAGTGGCTGGAAAATAATATAGGAGTG
AAACCTCGGTCCGGCTGGGCTATTGATCCCTTTGGACACTCACCAACAATGGCTTATCTT
CTAAACCGTGCTGGACTTTCTCACATGCTTATCCAGAGAGTTCATTATGCAGTTAAAAAA
CACTTTGCACTGCATAAAACATTGGAGTTTTTTTGGAGACAGAATTGGGATCTGGGATCT
GTCACAGATATTTTATGCCACATGATGCCCTTCTACAGCTATGACATCCCTCACACTTGT
GGACCTGATCCTAAAATATGCTGCCAGTTTGATTTTAAACGTCTTCCTGGAGGCAGATTT
GGTTGTCCCTGGGGAGTCCCCCCAGAAACAATACATCCTGGAAATGTCCAAAGCAGGGCT
CGGATGCTACTAGATCAGTACCGAAAGAAGTCAAAGCTTTTTCGTACCAAAGTTCTCCTG
GCTCCACTAGGAGATGATTTCCGCTACTGTGAATACACGGAATGGGATTTACAGTTTAAG
AATTATCAGCAGCTTTTTGATTATATGAATTCTCAGTCCAAGTTTAAAGTTAAGATACAG
TTTGGAACTTTATCAGATTTTTTTGATGCGCTGGATAAAGCAGATGAAACTCAGAGAGAC
AAGGGCCAATCGATGTTCCCTGTTTTAAGTGGAGATTTTTTCACTTATGCCGATCGAGAT
GATCATTACTGGAGTGGCTATTTTACATCCAGACCCTTTTACAAACGAATGGACAGAATC
ATGGAATCTCATTTAAGGGCTGCTGAAATTCTTTACTATTTCGCCCTGAGACAAGCTCAC
AAATACAAGATAAATAAATTTCTCTCATCATCACTTTACACGGCACTGACAGAAGCCAGA
AGGAATTTGGGACTGTTTCAACATCATGATGCTATCACAGGAACTGCAAAAGACTGGGTG
GTTGTGGATTATGGTACCAGACTTTTTCATTCGTTAATGGTTTTGGAGAAGATAATTGGA
AATTCTGCATTTCTTCTTATTTTGAAGGACAAACTCACATACGACTCTTACTCTCCTGAT
ACCTTCCTGGAGATGGATTTGAAACAAAAATCACAAGATTCTCTGCCACAAAAAAATATA
ATAAGGCTGAGTGCGGAGCCAAGGTACCTTGTGGTCTATAATCCTTTAGAACAAGACCGA
ATCTCGTTGGTCTCAGTCTATGTGAGTTCCCCGACAGTGCAAGTGTTCTCTGCTTCAGGA
AAACCTGTGGAAGTTCAAGTCAGCGCAGTTTGGGATACAGCAAATACTATTTCAGAAACA
GCCTATGAGATCTCTTTTCGAGCACATATACCGCCATTGGGACTGAAAGTGTATAAGATT
TTGGAATCAGCAAGTTCAAATTCACATTTAGCTGATTATGTCTTGTATAAGAATAAAGTA
GAAGATAGCGGAATTTTCACCATAAAGAATATGATAAATACTGAAGAAGGTATAACACTA
GAGAACTCCTTTGTTTTACTTCGGTTTGATCAAACTGGACTTATGAAGCAAATGATGACT
AAAGAAGATGGTAAACACCATGAAGTAAATGTGCAATTTTCATGGTATGGAACCACAATT
AAAAGAGACAAAAGTGGTGCCTACCTCTTCTTACCTGATGGTAATGCCAAGCCTTATGTT
TACACAACACCGCCCTTTGTCAGAGTGACACATGGAAGGATTTATTCGGAAGTGACTTGC
TTTTTTGACCATGTTACTCATAGAGTCCGACTATACCACATACAGGGAATAGAAGGACAG
TCTGTGGAAGTTTCCAATATTGTGGACATCCGAAAAGTATATAACCGTGAGATTGCAATG
AAAATTTCTTCTGATATAAAAAGCCAAAATAGATTTTATACTGACCTAAATGGGTACCAG
ATTCAACCTAGAATGACACTGAGCAAATTGCCTCTTCAAGCAAATGTCTATCCCATGACC
ACAATGGCCTATATCCAGGATGCCAAACATCGTTTGACACTGCTCTCTGCTCAGTCATTA
GGGGTTTCGAGTTTGAATAGTGGTCAGATTGAAGTTATCATGGATCGAAGACTCATGCAA
GATGATAATCGTGGCCTTGAGCAAGGTATCCAGGATAACAAGATTACAGCTAATCTATTT
CGAATACTACTAGAAAAAAGAAGTGCTGTTAATACGGAAGAAGAAAAGAAGTCGGTCAGT
TATCCTTCTCTCCTTAGCCACATAACTTCTTCTCTCATGAATCATCCAGTCATTCCAATG
GCAAATAAGTTCTCCTCACCTACCCTTGAGCTGCAAGGTGAATTCTCTCCATTACAGTCA
TCTTTGCCTTGTGACATTCATCTGGTTAATTTGAGAACAATACAGTCAAAGGTGGGCAAT
GGGCACTCCAATGAGGCAGCCTTGATCCTCCACAGAAAAGGGTTTGATTGTCGGTTCTCT
AGCAAAGGCACAGGGCTGTTTTGTTCTACTACTCAGGGAAAGATATTGGTACAGAAACTT
TTAAACAAGTTTATTGTCGAAAGTCTCACACCTTCATCACTATCCTTGATGCATTCACCT
CCCGGCACTCAGAATATAAGTGAGATCAACTTGAGTCCAATGGAAATCAGCACATTCCGA
ATCCAGTTGAGGTGA
Protein Properties
Number of Residues 1144
Molecular Weight 131139.485
Theoretical pI 7.573
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-mannosidase 2
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRNPRREGSFPQGQLSMLQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPKSSQSNFSQGAGSHLLPSQLSLSVDTADCLFAS
QSGSHNSDVQMLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGW
LKTFNDYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSLIEN
GQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTMAYL
LNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTC
GPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRTKVLL
APLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRD
KGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAH
KYKINKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLEKIIG
NSAFLLILKDKLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLSAEPRYLVVYNPLEQDR
ISLVSVYVSSPTVQVFSASGKPVEVQVSAVWDTANTISETAYEISFRAHIPPLGLKVYKI
LESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEGITLENSFVLLRFDQTGLMKQMMT
KEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTC
FFDHVTHRVRLYHIQGIEGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLNGYQ
IQPRMTLSKLPLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSGQIEVIMDRRLMQ
DDNRGLEQGIQDNKITANLFRILLEKRSAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPM
ANKFSSPTLELQGEFSPLQSSLPCDIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFS
SKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFR
IQLR
GenBank ID Protein 51477714
UniProtKB/Swiss-Prot ID Q16706
UniProtKB/Swiss-Prot Entry Name MA2A1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002372.2
GeneCard ID MAN2A1
GenAtlas ID MAN2A1
HGNC ID HGNC:6824
References
General References
  1. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  2. Misago M, Liao YF, Kudo S, Eto S, Mattei MG, Moremen KW, Fukuda MN: Molecular cloning and expression of cDNAs encoding human alpha-mannosidase II and a previously unrecognized alpha-mannosidase IIx isozyme. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11766-70. [PubMed:8524845 ]